ID Q7T2B9; PN Myotrophin; GN mtpn; OS 7955; SL Nucleus Position: SL-0198; SL Comments: Cytoplasm {ECO:0000250}. Nucleus {ECO:0000250}. Cytoplasm, perinuclear region {ECO:0000250}. DR UNIPROT: Q7T2B9; DR Pfam: PF12796; DR PROSITE: PS50297; DR PROSITE: PS50088; DE Function: Regulates NF-kappa-B transcription factor activity. Promotes growth of cardiomyocytes, but not cardiomyocyte proliferation. Promotes cardiac muscle hypertrophy. Plays a role in the regulation of the growth of actin filaments. Inhibits the activity of the F-actin-capping protein complex (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; GO GO:0005737; GO GO:0005634; GO GO:0048471; GO GO:2000812; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MGDKELMWALKNGDLDEVKNILVKAEDVNRTLEGGRKPLHYAADCGQAEMLEFLLSKGADVNAPDKHGITPLLSATYEGH SQ VTCVKILLEKGADKNRKGPDGLSAFEAAESEAIKALLE //