ID Q7ZY85; PN Nuclear envelope phosphatase-regulatory subunit 1; GN cnep1r1; OS 8355; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Comments: Nucleus membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Cytoplasm {ECO:0000250}. DR UNIPROT: Q7ZY85; DR Pfam: PF09771; DE Function: May form with the serine/threonine protein phosphatase ctdnep1 an active complex dephosphorylating and activating lipins. Lipins are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at different levels. May indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be required for proper nuclear membrane morphology and/or dynamics. May also indirectly regulate the production of lipid droplets and triacylglycerol (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; GO GO:0005737; GO GO:0016021; GO GO:0071595; GO GO:0031965; GO GO:0006629; GO GO:0035307; GO GO:0010867; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MNSLEQAEDLKAFERRLTEYVSCLQPTTGRWRMLLIVVSVCTATGAWNWLIDPETQKVSFFTSLWNHPFFTISCITLIGL SQ FFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKPRPHVQ //