ID  Q80UU9;
PN  Membrane-associated progesterone receptor component 2;
GN  Pgrmc2;
OS  10090;
SL  Nucleus Position: SL-0178;
SL  Comments: Membrane {ECO:0000305}; Single-pass membrane protein {ECO:0000305}. Nucleus envelope {ECO:0000250|UniProtKB:O15173}. Endoplasmic reticulum {ECO:0000250|UniProtKB:O15173}.
DR  UNIPROT: Q80UU9;
DR  Pfam: PF00173;
DE  Function: Required for the maintenance of uterine histoarchitecture and normal female reproductive lifespan (PubMed:28005395). May serve as a universal non-classical progesterone receptor in the uterus (Probable). Intracellular heme chaperone required for delivery of labile, or signaling heme, to the nucleus. Plays a role in adipocyte function and systemic glucose homeostasis. In brown fat, which has a high demand for heme, delivery of labile heme in the nucleus regulates the activity of heme-responsive transcriptional repressors such as NR1D1 and BACH1 (PubMed:31748741). {ECO:0000269|PubMed:28005395, ECO:0000269|PubMed:31748741, ECO:0000305|PubMed:28005395}.
DE  Reference Proteome: Yes;
DE  Interaction: O15173; IntAct: EBI-12523269; Score: 0.35
DE  Interaction: Q08460; IntAct: EBI-2024267; Score: 0.35
DE  Interaction: P68510; IntAct: EBI-8586548; Score: 0.35
DE  Interaction: Q8BP00; IntAct: EBI-4283417; Score: 0.35
DE  Interaction: P22830; IntAct: EBI-12523198; Score: 0.35
DE  Interaction: O00264; IntAct: EBI-12523216; Score: 0.35
GO  GO:0012505;
GO  GO:0005783;
GO  GO:0016021;
GO  GO:0016020;
GO  GO:0005635;
GO  GO:0020037;
GO  GO:0015232;
GO  GO:0005496;
GO  GO:0060612;
GO  GO:0015886;
TP  Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255};
SQ  MAAGDGDVKLSTLGSGGESGGDGSPGGAGATAARSSWVAALLATGGEMLLNVALVALVLLGAYRLWVRWGRRGLCSGPGA
SQ  GEESPAATLPRMKKRDFSLEQLRQYDGARTPRILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALR
SQ  DEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHSKQD
//