ID Q80VJ8; PN Protein KASH5; GN Kash5; OS 10090; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Nucleus Position: SL-0183; SL Comments: Nucleus outer membrane {ECO:0000269|PubMed:24062341, ECO:0000269|PubMed:26842404}; Single-pass type IV membrane protein {ECO:0000305}; Cytoplasmic side {ECO:0000305}. Nucleus {ECO:0000269|PubMed:22826121}. Chromosome, telomere {ECO:0000269|PubMed:22826121}. Note=Localized exclusively at telomeres from the leptotene to diplotene stages. Colocalizes with SUN2 at sites of telomere attachment in meiocytes. At oocyte MI stage localized around the spindle, at MII stage localized to the spindle poles. {ECO:0000269|PubMed:24586178, ECO:0000269|PubMed:26842404}. DR UNIPROT: Q80VJ8; DR UNIPROT: E9QNS3; DR UNIPROT: E9QQ69; DR Pfam: PF14658; DR Pfam: PF14662; DE Function: As a component of the LINC (LInker of Nucleoskeleton and Cytoskeleton) complex, involved in the connection between the nuclear lamina and the cytoskeleton. The nucleocytoplasmic interactions established by the LINC complex play an important role in the transmission of mechanical forces across the nuclear envelope and in nuclear movement and positioning. Required for telomere attachment to nuclear envelope in the prophase of meiosis and for rapid telomere prophase movements implicating a SUN1/2:KASH5 LINC complex in which SUN1 and SUN2 seem to act at least partial redundantly. Required for homolog pairing during meiotic prophase in spermatocytes and probably oocytes. Essential for male and female gametogenesis. Recruits cytoplasmic dynein to telomere attachment sites at the nuclear envelope in spermatocytes. In oocytes is involved in meiotic resumption and spindle formation. {ECO:0000269|PubMed:24062341, ECO:0000269|PubMed:25892231, ECO:0000269|PubMed:26842404}. DE Reference Proteome: Yes; DE Interaction: O08788; IntAct: EBI-11666413; Score: 0.35 DE Interaction: O94901; IntAct: EBI-11685143; Score: 0.27 DE Interaction: Q9D666; IntAct: EBI-11666366; Score: 0.59 DE Interaction: Q8BJS4; IntAct: EBI-11666392; Score: 0.37 DE Interaction: Q7TSY8; IntAct: EBI-11685119; Score: 0.37 DE Interaction: Q8C0V1; IntAct: EBI-16089819; Score: 0.35 GO GO:0000781; GO GO:0016021; GO GO:0000800; GO GO:0034993; GO GO:0090619; GO GO:0005640; GO GO:0070840; GO GO:0042802; GO GO:0007015; GO GO:0090220; GO GO:0000724; GO GO:0007129; GO GO:0090172; GO GO:0048477; GO GO:0007283; GO GO:0051225; GO GO:0051653; GO GO:0034397; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MHSILRSSLSSREALRMRQLKGLRKERPGRHPLGVRLRAIWTSFLFPNPPHSGGKLRASTAAVEEHQEWSMDLPEGQAGG SQ PTAQMYLWEQPEEASSRPLLSLEEQILNSTFEACDPHKTGTVTVAHLLAYLEAVTGQGPQDVRLQTLARSLDPYGEGAGA SQ TVELDTFLVVMRDWIAACQLQGGLERAEETAYEGALASPHLPSVCPEAEESANLESFGGEDPRPEGPATAELLSNLEDLE SQ LSNRRLAGENAKLQRSVETAEEGSARLGEEITALRKQLRSTQQALQVAKALDEELEDLKTLAKSLEEQNRSLMAQARHTE SQ KEQQHLAAEVETLQEENEKLLAERDGVKRRSEELATEKDALKRQLCECERLICQREAVLSERTRHAESLARTLEEYRTTT SQ QELRQEISNLEEQLSQSQEGPEELLEGAEAGRVGWIMALPPSLDLEIQAIRQEQDVASAGLSSPLYGVWQWEEVEPEPEP SQ EPEPEPEPEPQEVEFPSEDPARQQTDLQREPVRALEGSRAPCLRLSRSQEEEEEEEESWVLADPSSPLGTYHHKLAPGSS SQ RESCHIVPEMHQALMPVVRDLVPVERSRTQHCLHPQHSPGIRISQHPLVPTPVLGLLLLLLLSILLFSQSPPPTWPHLQL SQ YYLQPPPV //