ID Q861Q8; PN Optineurin; GN OPTN; OS 9544; SL Nucleus Position: SL-0198; SL Comments: Cytoplasm, perinuclear region {ECO:0000250}. Golgi apparatus {ECO:0000250|UniProtKB:Q96CV9}. Golgi apparatus, trans- Golgi network {ECO:0000250}. Cytoplasmic vesicle, autophagosome {ECO:0000250}. Cytoplasmic vesicle {ECO:0000250}. Recycling endosome {ECO:0000250}. Note=Found in the perinuclear region and associates with the Golgi apparatus. Colocalizes with MYO6 and RAB8 at the Golgi complex and in vesicular structures close to the plasma membrane. Localizes to LC3-positive cytoplasmic vesicles upon induction of autophagy. {ECO:0000250, ECO:0000250|UniProtKB:Q96CV9}. DR UNIPROT: Q861Q8; DR Pfam: PF16516; DR Pfam: PF11577; DR PROSITE: PS51801; DE Function: Plays an important role in the maintenance of the Golgi complex, in membrane trafficking, in exocytosis, through its interaction with myosin VI and Rab8. Links myosin VI to the Golgi complex and plays an important role in Golgi ribbon formation. Negatively regulates the induction of IFNB in response to RNA virus infection. Plays a neuroprotective role in the eye and optic nerve. Probably part of the TNF-alpha signaling pathway that can shift the equilibrium toward induction of cell death. May act by regulating membrane trafficking and cellular morphogenesis via a complex that contains Rab8 and hungtingtin (HD). Mediates the interaction of Rab8 with the probable GTPase-activating protein TBC1D17 during Rab8- mediated endocytic trafficking, such as of transferrin receptor (TFRC/TfR); regulates Rab8 recruitnment to tubules emanating from the endocytic recycling compartment. Autophagy receptor that interacts directly with both the cargo to become degraded and an autophagy modifier of the MAP1 LC3 family; targets ubiquitin-coated bacteria (xenophagy) and appears to function in the same pathway as SQSTM1 and CALCOCO2/NDP52. {ECO:0000250, ECO:0000250|UniProtKB:Q96CV9}. DE Reference Proteome: Yes; GO GO:0005776; GO GO:0005737; GO GO:0005794; GO GO:0005634; GO GO:0048471; GO GO:0055037; GO GO:0005802; GO GO:0070530; GO GO:0046872; GO GO:0006914; GO GO:0034620; GO GO:0090161; GO GO:0034067; GO GO:0043122; GO GO:0016192; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MSHQPLSCLTEKGDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQAMKGRFEELSAWTEKQK SQ EERQFFETQSKEAKERLMALSHENEKLKEELGKLKGKSERSSEDPTDDSRLPRAEAEQEKDQLRTQVTRLQAEKADLLGI SQ VSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSIGTSRSAEGAKNYLEHEELTVSQLLLCLREGNQK SQ VERLEIALKEAKERVSDFEKKASNRSEIETQTEGSTEKENEEEKGPETVGSEVEALNLQVTSLFKELQEAHTKLSEAELM SQ KKRLQEKCQALERKNSATPSELNEKQELVYTNKKLELQVESMLSEIKMEQAKTEDEKSKLAMLQLTHNKLLQEHNHALKT SQ IEELTRKESEKVDRAVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTVLRAQMEVYCSDFHAERAAREKIH SQ EEKEQLALQLAVLLKENDAFEDGGRQSLMEMQSRHGARTSDPDQQAYLVQRGTEDRDWQQQRNIPIHSCPKCGEVLPDID SQ TLQIHVMDCII //