ID Q863Z4; PN Myotrophin; GN MTPN; OS 9615; SL Nucleus Position: SL-0198; SL Comments: Cytoplasm {ECO:0000250}. Nucleus {ECO:0000250}. Cytoplasm, perinuclear region {ECO:0000250}. DR UNIPROT: Q863Z4; DR Pfam: PF12796; DR PROSITE: PS50297; DR PROSITE: PS50088; DE Function: Promotes dimerization of NF-kappa-B subunits and regulates NF-kappa-B transcription factor activity. Promotes growth of cardiomyocytes, but not cardiomyocyte proliferation. Promotes cardiac muscle hypertrophy. Plays a role in the regulation of the growth of actin filaments. Inhibits the activity of the F-actin-capping protein complex formed by the CAPZA1 and CAPZB heterodimer (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; GO GO:0030424; GO GO:0005737; GO GO:0005829; GO GO:0008290; GO GO:0005634; GO GO:0048471; GO GO:0010613; GO GO:0030307; GO GO:0010557; GO GO:0051092; GO GO:0051247; GO GO:2000812; GO GO:0008361; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGH SQ VSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ //