ID Q86YW0; PN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1; GN PLCZ1; OS 9606; SL Nucleus Position: SL-0198; SL Comments: Nucleus {ECO:0000250|UniProtKB:Q8K4D7}. Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:Q8K4D7}. Note=Exhibits alternative cytoplasmic/nuclear localization during development. Translocates from the pronucleus into cytoplasm upon nuclear envelope breakdown for mitosis and localizes again to the pronucleus at interphase following meiosis and mitosis (By similarity). {ECO:0000250|UniProtKB:Q8K4D7}. DR UNIPROT: Q86YW0; DR UNIPROT: Q08AQ7; DR UNIPROT: Q96J70; DR Pfam: PF00168; DR Pfam: PF09279; DR Pfam: PF00388; DR Pfam: PF00387; DR PROSITE: PS50004; DR PROSITE: PS50222; DR PROSITE: PS50007; DR PROSITE: PS50008; DR OMIM: 608075; DR OMIM: 617214; DR DisGeNET: 89869; DE Function: The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. In vitro, hydrolyzes PtdIns(4,5)P2 in a Ca(2+)-dependent manner. Triggers intracellular Ca(2+) oscillations in oocytes solely during M phase and is involved in inducing oocyte activation and initiating embryonic development up to the blastocyst stage. Is therefore a strong candidate for the egg-activating soluble sperm factor that is transferred from the sperm into the egg cytoplasm following gamete membrane fusion. May exert an inhibitory effect on phospholipase-C-coupled processes that depend on calcium ions and protein kinase C, including CFTR trafficking and function. {ECO:0000250|UniProtKB:Q8K4D7, ECO:0000269|PubMed:12416999, ECO:0000269|PubMed:14697805, ECO:0000269|PubMed:15579586, ECO:0000269|PubMed:26721930, ECO:0000305}. DE Disease: Spermatogenic failure 17 (SPGF17) [MIM:617214]: An autosomal recessive infertility disorder due to failure of oocyte activation and fertilization by sperm that otherwise exhibits normal morphology. {ECO:0000269|PubMed:26721930}. Note=The disease is caused by variants affecting the gene represented in this entry. DE Reference Proteome: Yes; DE Interaction: Q15828; IntAct: EBI-21829478; Score: 0.35 DE Interaction: Q8IW75; IntAct: EBI-21829478; Score: 0.35 DE Interaction: Q16610; IntAct: EBI-21829478; Score: 0.35 DE Interaction: P49862; IntAct: EBI-21829478; Score: 0.35 DE Interaction: P42357; IntAct: EBI-21829478; Score: 0.35 DE Interaction: P04279; IntAct: EBI-21829478; Score: 0.35 DE Interaction: P06748; IntAct: EBI-20903472; Score: 0.40 DE Interaction: P68032; IntAct: EBI-20905688; Score: 0.40 DE Interaction: P14314; IntAct: EBI-20907800; Score: 0.40 GO GO:0005829; GO GO:0005730; GO GO:0005654; GO GO:0005634; GO GO:0048471; GO GO:0045120; GO GO:0061827; GO GO:0005509; GO GO:0004435; GO GO:0032266; GO GO:0005546; GO GO:0010314; GO GO:0006816; GO GO:0007343; GO GO:0016042; GO GO:0048015; GO GO:0007204; GO GO:0060470; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MEMRWFLSKIQDDFRGGKINLEKTQRLLEKLDIRCSYIHVKQIFKDNDRLKQGRITIEEFRAIYRIITHREEIIEIFNTY SQ SENRKILLASNLAQFLTQEQYAAEMSKAIAFEIIQKYEPIEEVRKAHQMSLEGFTRYMDSRECLLFKNECRKVYQDMTHP SQ LNDYFISSSHNTYLVSDQLLGPSDLWGYVSALVKGCRCLEIDCWDGAQNEPVVYHGYTLTSKLLFKTVIQAIHKYAFMTS SQ DYPVVLSLENHCSTAQQEVMADNLQATFGESLLSDMLDDFPDTLPSPEALKFKILVKNKKIGTLKETHERKGSDKRGDNQ SQ DKETGVKKLPGVMLFKKKKTRKLKIALALSDLVIYTKAEKFKSFQHSRLYQQFNENNSIGETQARKLSKLRVHEFIFHTR SQ KFITRIYPKATRADSSNFNPQEFWNIGCQMVALNFQTPGLPMDLQNGKFLDNGGSGYILKPHFLRESKSYFNPSNIKEGM SQ PITLTIRLISGIQLPLTHSSSNKGDSLVIIEVFGVPNDQMKQQTRVIKKNAFSPRWNETFTFIIHVPELALIRFVVEGQG SQ LIAGNEFLGQYTLPLLCMNKGYRRIPLFSRMGESLEPASLFVYVWYVR //