ID Q8B0H2; PN Matrix protein; GN M; OS 434489; SL Nucleus Position: SL-0415; SL Nucleus Position: SL-0418; SL Comments: Virion membrane {ECO:0000250|UniProtKB:P03519}; Peripheral membrane protein {ECO:0000250|UniProtKB:P03519}. Host endomembrane system {ECO:0000250|UniProtKB:P03519}; Peripheral membrane protein {ECO:0000250|UniProtKB:P03519}. Host nucleus membrane {ECO:0000250|UniProtKB:P03519}; Peripheral membrane protein {ECO:0000250|UniProtKB:P03519}. Host nucleus {ECO:0000250|UniProtKB:P03519}. Host cytoplasm {ECO:0000250|UniProtKB:P03519}. DR UNIPROT: Q8B0H2; DR PDB: 1LG7; DR Pfam: PF06326; DE Function: Plays a major role in assembly and budding of virion, by recruiting cellular partners of the ESCRT complexes that play a key role in releasing the budding particle from the host membrane. Condensates the ribonucleocapsid core during virus assembly. {ECO:0000250|UniProtKB:P03519}. Inhibits mRNA nuclear export through direct interaction with host RAE1-NUP98 complex, thereby preventing interferon signaling and establishment of antiviral state in infected cells. Induces cell- rounding, cytoskeleton disorganization and apoptosis in infected cell. Inhibits host transcription, possibly through interaction with host DNA repair factor IIH/TFIIH GTF2H5 subunit (By similarity). {ECO:0000250|UniProtKB:P03519}. DE Reference Proteome: No; GO GO:0030430; GO GO:0044200; GO GO:0016020; GO GO:0019031; GO GO:0055036; GO GO:0039660; GO GO:0039522; GO GO:0039602; GO GO:0039702; TP Membrane Topology: Peripheral; Source: UniProt - By Similarity {ECO:0000250|UniProtKB:P03519}; SQ MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTHDPNQLRYEKFFFTVKMTVRSNRPFRT SQ YSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADRGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRR SQ PFNIGLYKGTVELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEKKASGAWVLDSVSHFK //