ID  Q8BRE0;
PN  Protein RD3;
GN  Rd3;
OS  10090;
SL  Nucleus Position: SL-0198;
SL  Comments: Cell projection, cilium, photoreceptor outer segment {ECO:0000269|PubMed:21078983, ECO:0000269|PubMed:29515371}. Photoreceptor inner segment {ECO:0000269|PubMed:21078983, ECO:0000269|PubMed:29515371}. Endosome {ECO:0000269|PubMed:21078983}. Nucleus {ECO:0000269|PubMed:17186464}. Cytoplasm {ECO:0000250|UniProtKB:Q7Z3Z2}. Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:Q7Z3Z2}. Note=Colocalizes with GUCY2E and GUCY2F in rods and cones photoreceptors. Colocalizes with GUK1 in photoreceptor inner segments and to a lesser extent in the outer plexiform layer (PubMed:29515371). Strong dot-like perinuclear staining in the epithelial cells (By similarity). {ECO:0000250|UniProtKB:Q7Z3Z2, ECO:0000269|PubMed:29515371}.
DR  UNIPROT: Q8BRE0;
DR  UNIPROT: Q3SYJ8;
DR  UNIPROT: Q9CRS3;
DR  UNIPROT: Q9JMF2;
DR  Pfam: PF14473;
DE  Function: Plays a critical role in the regulation of enzymes involved in nucleotide cycle in photoreceptors (PubMed:21078983, PubMed:27471269). Inhibits the basal catalytic activity and the GCAP- stimulated activity of GUCY2E and GUCY2F, two retinal guanylyl cyclases involved in the production of cGMP in photoreceptors (PubMed:27471269). Involved in the transport of GUCY2E and GUCY2F to their target sites in the photoreceptor outer segment (PubMed:21078983). Up-regulates the activity of GUK1, a kinase that also plays an essential role for recycling GMP and indirectly, cGMP (By similarity). Plays an important role for the survival of rods and cones in the retina (PubMed:8486383, PubMed:17186464). {ECO:0000250|UniProtKB:Q7Z3Z2, ECO:0000269|PubMed:17186464, ECO:0000269|PubMed:21078983, ECO:0000269|PubMed:27471269, ECO:0000269|PubMed:8486383}.
DE  Disease: Note=A spontaneous mutation leading to a frameshift and in an unstable truncated protein lacking the C-terminal 89 amino acids causes retinal degeneration. Homozygotes mice (called rd-3) display retinal degeneration, beginning at 3 weeks of age, characterized by complete loss of photoreceptor rod cells by 5 weeks, and cones by 8 weeks. {ECO:0000269|PubMed:17186464, ECO:0000269|PubMed:8486383}.
DE  Reference Proteome: Yes;
DE  Interaction: Q8BMK4; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: Q07797; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P15409; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P38647; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: Q925I1; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: Q8CAQ8; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: O08553; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P10126; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: O35129; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P20152; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P62874; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P29974; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P15499; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P27546; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: Q9D6R2; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: Q01853; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: Q91VR2; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: Q61595; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P27664; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P16858; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: Q8CJ40; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P46460; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: Q7TPR4; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: O70318; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P15105; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P20029; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: Q8BH59; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P20612; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: Q8VDN2; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P51881; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P20443; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P17182; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P60710; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: Q03265; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P46096; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: Q6PIC6; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P48962; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: Q5SDA5; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: Q68FD5; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P63017; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P56480; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P05213; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P16546; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P99024; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: Q62261; IntAct: EBI-20718973; Score: 0.35
DE  Interaction: P52785; IntAct: EBI-20718973; Score: 0.35
GO  GO:0120199;
GO  GO:0005737;
GO  GO:0005768;
GO  GO:0005634;
GO  GO:0048471;
GO  GO:0001917;
GO  GO:0001750;
GO  GO:0120200;
GO  GO:0031283;
GO  GO:0015031;
GO  GO:0050896;
GO  GO:0060041;
GO  GO:0007601;
TP  Membrane Topology: Unknown; Source: UniProt - Sequence Analysis;
SQ  MSLIPWLRWNDTPPRLSARTPAEMVLETLMMELAGQMREVERQQRERRSAVRKICTGVDYSWLANTPRPTYDISPGERLQ
SQ  LEDVCAKIHPSYCGPAILRFRQLLAEREPEVQEVARLFRSVLQEALEKMKQEEEAHKLTRQWSLRPRGSLSSFKTRARIA
SQ  PFASDIRTISEDVERDAPPPPRTWSMPEFRAPQAD
//