ID Q8HZJ2; PN Prostaglandin E synthase; GN PTGES; OS 9796; SL Nucleus Position: SL-0198; SL Comments: Membrane {ECO:0000250|UniProtKB:O14684}; Multi- pass membrane protein {ECO:0000250|UniProtKB:O14684}. Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:O14684}. Note=Colocalizes with PTGS1/COX-1 and PTGS2/COX-2 in the perinuclear compartment. {ECO:0000250|UniProtKB:O14684}. DR UNIPROT: Q8HZJ2; DR Pfam: PF01124; DE Function: Terminal enzyme of the cyclooxygenase (COX)-2-mediated prostaglandin E2 (PGE2) biosynthetic pathway. Catalyzes the glutathione-dependent oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2) in response to inflammatory stimuli (By similarity). Plays a key role in inflammation response, fever and pain (By similarity). Catalyzes also the oxidoreduction of endocannabinoids into prostaglandin glycerol esters and PGG2 into 15- hydroperoxy-PGE2. In addition, displays low glutathione transferase and glutathione-dependent peroxidase activities, toward 1-chloro-2,4- dinitrobenzene and 5-hydroperoxyicosatetraenoic acid (5-HPETE), respectively (By similarity). {ECO:0000250|UniProtKB:O14684, ECO:0000250|UniProtKB:Q9JM51}. DE Reference Proteome: Yes; GO GO:0016021; GO GO:0005641; GO GO:0048471; GO GO:0043295; GO GO:0004602; GO GO:0004364; GO GO:0004667; GO GO:0050220; GO GO:0008283; GO GO:0008285; GO GO:0032308; GO GO:0001516; GO GO:0031620; GO GO:0050727; GO GO:0019233; TP Membrane Topology: Transmembrane; Source: UniProt - By Similarity {ECO:0000250|UniProtKB:O14684}; SQ MPPPSLAMVSGQALPAFLLCSTLLVIKMYAVAVITGQVRLRKKAFANPEDALRHGGLQFHRDDQDVERCLRAHRNDMETI SQ YPFLFLGLVYSFLGPDPFVAQMHFLVFFLGRMVHTVAYLGKLRAPTRSLAYTVAQLPCASMALQIVWEAARHL //