ID  Q8IY26;
PN  Polyisoprenoid diphosphate/phosphate phosphohydrolase PLPP6;
GN  PLPP6;
OS  9606;
SL  Nucleus Position: SL-0178;
SL  Nucleus Position: SL-0179;
SL  Nucleus Position: SL-0182;
SL  Comments: Endoplasmic reticulum membrane {ECO:0000269|PubMed:16464866, ECO:0000269|PubMed:18930839, ECO:0000269|PubMed:20110354}; Multi-pass membrane protein {ECO:0000305|PubMed:20110354}. Nucleus envelope {ECO:0000269|PubMed:18930839}. Nucleus inner membrane {ECO:0000305|PubMed:20110354}.
DR  UNIPROT: Q8IY26;
DR  UNIPROT: B3KY05;
DR  UNIPROT: Q5JVJ6;
DR  UNIPROT: Q8NCK9;
DR  Pfam: PF01569;
DR  OMIM: 611666;
DR  DisGeNET: 403313;
DE  Function: Magnesium-independent polyisoprenoid diphosphatase that catalyzes the sequential dephosphorylation of presqualene, farnesyl, geranyl and geranylgeranyl diphosphates (PubMed:16464866, PubMed:19220020, PubMed:20110354). Functions in the innate immune response through the dephosphorylation of presqualene diphosphate which acts as a potent inhibitor of the signaling pathways contributing to polymorphonuclear neutrophils activation (PubMed:16464866, PubMed:23568778). May regulate the biosynthesis of cholesterol and related sterols by dephosphorylating presqualene and farnesyl diphosphate, two key intermediates in this biosynthetic pathway (PubMed:20110354). May also play a role in protein prenylation by acting on farnesyl diphosphate and its derivative geranylgeranyl diphosphate, two precursors for the addition of isoprenoid anchors to membrane proteins (PubMed:20110354). Has a lower activity towards phosphatidic acid (PA), but through phosphatidic acid dephosphorylation may participate in the biosynthesis of phospholipids and triacylglycerols (PubMed:18930839). May also act on ceramide-1-P, lysophosphatidic acid (LPA) and sphing-4-enine 1-phosphate/sphingosine- 1-phosphate (PubMed:18930839, PubMed:20110354). {ECO:0000269|PubMed:16464866, ECO:0000269|PubMed:18930839, ECO:0000269|PubMed:19220020, ECO:0000269|PubMed:20110354, ECO:0000269|PubMed:23568778}.
DE  Reference Proteome: Yes;
DE  Interaction: Q15125; IntAct: EBI-24647840; Score: 0.56
DE  Interaction: Q5JX71; IntAct: EBI-24705960; Score: 0.56
DE  Interaction: P03182; IntAct: EBI-11721938; Score: 0.35
DE  Interaction: P06460; IntAct: EBI-11723082; Score: 0.35
DE  Interaction: P06461; IntAct: EBI-11723785; Score: 0.35
DE  Interaction: P06792; IntAct: EBI-11724527; Score: 0.35
DE  Interaction: P0C739; IntAct: EBI-11725101; Score: 0.35
DE  Interaction: P0CK56; IntAct: EBI-11725466; Score: 0.35
DE  Interaction: P69901; IntAct: EBI-11733364; Score: 0.35
DE  Interaction: Q16623; IntAct: EBI-24308796; Score: 0.56
DE  Interaction: Q96BA8; IntAct: EBI-24358086; Score: 0.56
DE  Interaction: Q99942; IntAct: EBI-25250644; Score: 0.56
DE  Interaction: Q8N205; IntAct: EBI-24502926; Score: 0.56
DE  Interaction: Q9BVX2; IntAct: EBI-24526872; Score: 0.56
DE  Interaction: Q9NS71; IntAct: EBI-24620536; Score: 0.56
DE  Interaction: Q68D85; IntAct: EBI-24663138; Score: 0.56
DE  Interaction: Q13520; IntAct: EBI-24665438; Score: 0.56
DE  Interaction: Q96KR7; IntAct: EBI-24675213; Score: 0.56
DE  Interaction: P11912; IntAct: EBI-24675949; Score: 0.56
DE  Interaction: Q96K19; IntAct: EBI-24679699; Score: 0.56
DE  Interaction: Q9BY50; IntAct: EBI-24684166; Score: 0.56
DE  Interaction: Q14627; IntAct: EBI-24690777; Score: 0.56
DE  Interaction: Q3SXP7; IntAct: EBI-23741658; Score: 0.56
DE  Interaction: Q8TBB6; IntAct: EBI-24709774; Score: 0.56
DE  Interaction: Q8TBE3; IntAct: EBI-24715286; Score: 0.56
DE  Interaction: Q86WK6; IntAct: EBI-23772817; Score: 0.56
DE  Interaction: Q8WWF3; IntAct: EBI-24726073; Score: 0.56
DE  Interaction: O94778; IntAct: EBI-24726609; Score: 0.56
DE  Interaction: P16471; IntAct: EBI-23796159; Score: 0.56
DE  Interaction: Q9UBN6; IntAct: EBI-24733686; Score: 0.56
DE  Interaction: Q13113; IntAct: EBI-24744120; Score: 0.56
DE  Interaction: Q8TBG9; IntAct: EBI-24748614; Score: 0.56
DE  Interaction: Q96PQ1; IntAct: EBI-23825067; Score: 0.56
DE  Interaction: O95484; IntAct: EBI-24754063; Score: 0.56
DE  Interaction: P15151; IntAct: EBI-24755178; Score: 0.56
DE  Interaction: Q9H5X1; IntAct: EBI-23854556; Score: 0.56
DE  Interaction: Q9Y680; IntAct: EBI-24767186; Score: 0.56
DE  Interaction: Q13651; IntAct: EBI-24768822; Score: 0.56
DE  Interaction: Q7KYR7; IntAct: EBI-24769740; Score: 0.56
DE  Interaction: Q8N4V1; IntAct: EBI-24782120; Score: 0.56
DE  Interaction: Q9H2X3; IntAct: EBI-24784754; Score: 0.56
DE  Interaction: Q6UX15; IntAct: EBI-24786495; Score: 0.56
DE  Interaction: O95377; IntAct: EBI-24786749; Score: 0.56
DE  Interaction: Q5T7V8; IntAct: EBI-24787652; Score: 0.56
DE  Interaction: Q8TBP5; IntAct: EBI-24793718; Score: 0.56
DE  Interaction: Q96LL3; IntAct: EBI-25275685; Score: 0.56
DE  Interaction: P15941; IntAct: EBI-25280137; Score: 0.56
DE  Interaction: Q8N6L0; IntAct: EBI-24446133; Score: 0.56
DE  Interaction: Q5T700; IntAct: EBI-24457346; Score: 0.56
DE  Interaction: Q96FX9; IntAct: EBI-24535956; Score: 0.56
DE  Interaction: A0A024R644; IntAct: EBI-24558177; Score: 0.56
DE  Interaction: P21964; IntAct: EBI-24574096; Score: 0.56
DE  Interaction: Q96HJ5; IntAct: EBI-24595440; Score: 0.56
DE  Interaction: P16234; IntAct: EBI-24599449; Score: 0.56
DE  Interaction: Q6UXG8; IntAct: EBI-25151294; Score: 0.56
DE  Interaction: Q8TED1; IntAct: EBI-24760742; Score: 0.56
DE  Interaction: Q9H7M9; IntAct: EBI-25188861; Score: 0.56
DE  Interaction: Q86VR2; IntAct: EBI-25196945; Score: 0.56
DE  Interaction: Q14802; IntAct: EBI-24802281; Score: 0.56
DE  Interaction: Q96KR6; IntAct: EBI-24808861; Score: 0.56
DE  Interaction: Q0VAQ4; IntAct: EBI-25226356; Score: 0.56
DE  Interaction: P03372; IntAct: EBI-21301141; Score: 0.35
DE  Interaction: P0DOF2; IntAct: EBI-25603126; Score: 0.35
DE  Interaction: H9EJ66; IntAct: EBI-25685143; Score: 0.35
GO  GO:0030176;
GO  GO:0016020;
GO  GO:0005637;
GO  GO:0031965;
GO  GO:0005886;
GO  GO:0016787;
GO  GO:0106405;
GO  GO:0042577;
GO  GO:0016829;
GO  GO:0052642;
GO  GO:0008195;
GO  GO:0042392;
GO  GO:0006695;
GO  GO:0045339;
GO  GO:0033383;
GO  GO:1902247;
GO  GO:0045087;
GO  GO:0006720;
GO  GO:0046839;
GO  GO:1902565;
GO  GO:0018342;
TP  Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255};
SQ  MPSPRRSMEGRPLGVSASSSSSSPGSPAHGGGGGGSRFEFQSLLSSRATAVDPTCARLRASESPVHRRGSFPLAAAGPSQ
SQ  SPAPPLPEEDRMDLNPSFLGIALRSLLAIDLWLSKKLGVCAGESSSWGSVRPLMKLLEISGHGIPWLLGTLYCLCRSDSW
SQ  AGREVLMNLLFALLLDLLLVALIKGLVRRRRPAHNQMDMFVTLSVDKYSFPSGHATRAALMSRFILNHLVLAIPLRVLVV
SQ  LWAFVLGLSRVMLGRHNVTDVAFGFFLGYMQYSIVDYCWLSPHNAPVLFLLWSQR
//