ID Q8NHR7; PN Telomere repeats-binding bouquet formation protein 2; GN TERB2; OS 9606; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0179; SL Nucleus Position: SL-0182; SL Comments: Chromosome, telomere {ECO:0000250|UniProtKB:Q9D494}. Nucleus inner membrane {ECO:0000250|UniProtKB:Q9D494}. Note=Localizes to telomeres throughout meiotic prophase I and disappears in metaphase I. In leptotene spermatocytes, localizes to telomeres that localize to the nucleus inner membrane. {ECO:0000250|UniProtKB:Q9D494}. DR UNIPROT: Q8NHR7; DR PDB: 6GNX; DR PDB: 6GNY; DR PDB: 6J07; DR PDB: 6J08; DR Pfam: PF15101; DR OMIM: 617131; DR OMIM: 619645; DE Function: Meiosis-specific telomere-associated protein involved in meiotic telomere attachment to the nucleus inner membrane, a crucial step for homologous pairing and synapsis. Component of the MAJIN-TERB1- TERB2 complex, which promotes telomere cap exchange by mediating attachment of telomeric DNA to the inner nuclear membrane and replacement of the protective cap of telomeric chromosomes: in early meiosis, the MAJIN-TERB1-TERB2 complex associates with telomeric DNA and the shelterin/telosome complex. During prophase, the complex matures and promotes release of the shelterin/telosome complex from telomeric DNA. {ECO:0000250|UniProtKB:Q9D494}. DE Disease: Spermatogenic failure 59 (SPGF59) [MIM:619645]: An autosomal recessive male infertility disorder characterized by non-obstructive azoospermia, due to sperm maturation arrest. {ECO:0000269|PubMed:33377991}. Note=The disease may be caused by variants affecting the gene represented in this entry. DE Reference Proteome: Yes; DE Interaction: Q3KP22; IntAct: EBI-23751777; Score: 0.56 GO GO:0000781; GO GO:0005637; GO GO:0007129; GO GO:0070197; GO GO:0045141; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MFQGQRGWFCGSVSQDLRQFWVAEGGTISDPRAADFLFSCDASHPDTLRIYQSLDYIEDNATVFHAYYLSAVANAKIKNS SQ VALGHFILPPACLQKEIRRKIGSFIWEQDQHFLIEKHDEVTPNEIKTLRENSELATEHKKELSKSPEKHFIRTPVVEKQM SQ YFPLQNYPVNNMVTGYISIDAMKKFLGELHDFIPGTSGYLAYHVQNEINMSAIKNKLKRK //