ID Q8R2U0; PN Nucleoporin SEH1; GN Seh1l; OS 10090; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0185; SL Comments: Chromosome, centromere, kinetochore {ECO:0000250|UniProtKB:Q96EE3}. Nucleus, nuclear pore complex {ECO:0000250|UniProtKB:Q96EE3}. Lysosome membrane {ECO:0000250|UniProtKB:Q96EE3}. DR UNIPROT: Q8R2U0; DR UNIPROT: Q3TLC9; DR UNIPROT: Q3UP79; DR UNIPROT: Q9D0K7; DR Pfam: PF00400; DR PROSITE: PS50082; DR PROSITE: PS50294; DE Function: Component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation. This subunit plays a role in recruitment of the Nup107-160 subcomplex to the kinetochore. {ECO:0000250|UniProtKB:Q96EE3}. As a component of the GATOR subcomplex GATOR2, functions within the amino acid-sensing branch of the TORC1 signaling pathway. Indirectly activates mTORC1 and the TORC1 signaling pathway through the inhibition of the GATOR1 subcomplex. It is negatively regulated by the upstream amino acid sensors SESN2 and CASTOR1. {ECO:0000250|UniProtKB:Q96EE3}. DE Reference Proteome: Yes; GO GO:0061700; GO GO:0000776; GO GO:0005765; GO GO:0005635; GO GO:0005643; GO GO:0031080; GO GO:0035859; GO GO:0005198; GO GO:0051315; GO GO:0051301; GO GO:0034198; GO GO:0050830; GO GO:0007080; GO GO:0051028; GO GO:0006999; GO GO:0006913; GO GO:0032008; GO GO:1904263; GO GO:0015031; GO GO:0031503; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSVWRVTWAHPEFGQVLASCSFD SQ RTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGIVRVYEAPDVMNLSQWSLQHEVS SQ CKLCCSCISWNPSSSRAHPPMIAVGSDDSSPNSMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHILAV SQ ATKDVRIFTLKPLRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDGCVRLWKANYMDNWKCTGILK SQ GNGSPVNGSSQLGNSNPSLSSNIPNLQNSLNGTSASRKHS //