ID Q8R411; PN Myc target protein 1; GN Myct1; OS 10090; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Comments: Nucleus membrane {ECO:0000305}; Single-pass membrane protein {ECO:0000305}. DR UNIPROT: Q8R411; DR UNIPROT: Q3UQ11; DR UNIPROT: Q8C6M8; DR UNIPROT: Q9D182; DR Pfam: PF15179; DE Function: May regulate certain MYC target genes, MYC seems to be a direct upstream transcriptional activator. Does not seem to significantly affect growth cell capacity. Overexpression seems to mediate many of the known phenotypic features associated with MYC, including promotion of apoptosis, alteration of morphology, enhancement of anchorage-independent growth, tumorigenic conversion, promotion of genomic instability and inhibition of hematopoietic differentiation. {ECO:0000269|PubMed:11909865}. DE Reference Proteome: Yes; GO GO:0016021; GO GO:0043231; GO GO:0031965; GO GO:0005654; GO GO:0061484; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MANNTTSLGSPWPENFWEDLIMSFTVSVAIGLAIGGFLWALFVFLSRRRRASAPISQWSPTRRPRSSYNHGLNRTGFYRH SQ SGYERRSNLSLASLTFQRQASMELVNSFPRKSSFRASTFHPFLQCPPLPVETESQLMTLSASTTPSTLSTAHSPSRPDFR SQ WSSNSLRMGLSTPPPPAYESIIKAFPDS //