ID Q8R4R6; PN Nucleoporin NUP35; GN Nup35; OS 10090; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Nucleus Position: SL-0185; SL Comments: Nucleus, nuclear pore complex {ECO:0000250|UniProtKB:Q8NFH5}. Nucleus membrane {ECO:0000250|UniProtKB:Q8NFH5}; Peripheral membrane protein {ECO:0000250|UniProtKB:Q8NFH5}. Note=Tightly associated with the nuclear membrane and lamina. {ECO:0000250|UniProtKB:Q8NFH5}. DR UNIPROT: Q8R4R6; DR UNIPROT: A2ATJ3; DR UNIPROT: Q9D7J2; DR PDB: 1WWH; DR Pfam: PF05172; DR PROSITE: PS51472; DE Function: Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. May play a role in the association of MAD1 with the NPC (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; DE Interaction: P68510; IntAct: EBI-8586548; Score: 0.35 GO GO:0005635; GO GO:0005652; GO GO:0031965; GO GO:0005643; GO GO:0044613; GO GO:0044615; GO GO:0005654; GO GO:0005886; GO GO:0042802; GO GO:0005543; GO GO:0003697; GO GO:0017056; GO GO:1990830; GO GO:0051028; GO GO:0006607; GO GO:0006999; GO GO:0006913; GO GO:0006355; TP Membrane Topology: Peripheral; Source: UniProt - By Similarity {ECO:0000250|UniProtKB:Q8NFH5}; SQ MAAFAVDPQAPTLGSEPMMLGSPTSPKTGANAQFLPGFLMGDLPAPVTPQPRSISGPSVGVMEMRSPLLAGGSPPQPVVP SQ AHKDKSGAPPVRSIYDDISSPGLGSTPLTSRRQANISLLQSPLVGATTPVPGQSMFSPANIGQPRKTTLSPAQLDPFYTQ SQ GDSLTSEDHLDDTWVTVFGFPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGVK SQ PCIDKNVMENSDRGVLSSPSLAFTTPIRTLGTPTQSGSTPRVSTMRPLATAYKASTSDYQVISDRQTPKKDESLVSRAME SQ YMFGW //