ID Q8T0B1; PN Nuclear envelope phosphatase-regulatory subunit 1 homolog; GN CG8009; OS 7227; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Comments: Nucleus membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Cytoplasm {ECO:0000250}. DR UNIPROT: Q8T0B1; DR UNIPROT: Q9VTA4; DR Pfam: PF09771; DE Function: May form with the serine/threonine protein phosphatase l(1)G0269 an active complex dephosphorylating and activating lipin-like phosphatases. Lipins are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at different levels (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; DE Interaction: Q9VDS3; IntAct: EBI-26746382; Score: 0.49 DE Interaction: Q6AWP0; IntAct: EBI-26770829; Score: 0.49 GO GO:0005737; GO GO:0030176; GO GO:0071595; GO GO:0031965; GO GO:0006629; GO GO:0035307; GO GO:0010867; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MEPSACEDLKAFERRLTEVVSSYRPSTFRWRKLLAVVLSAMSMCTAISAWYWLRDPRTTVVPLTESLWIHPVFTVATLTL SQ VVLFILGIQKLVIAPQIITSRTRMVLGDFNMSCDDTGKLILKPRQSNNNST //