ID Q8WVE7; PN Transmembrane protein 170A; GN TMEM170A; OS 9606; SL Nucleus Position: SL-0178; SL Comments: Endoplasmic reticulum membrane {ECO:0000269|PubMed:26906412}; Multi-pass membrane protein {ECO:0000255}. Nucleus envelope {ECO:0000269|PubMed:26906412}. DR UNIPROT: Q8WVE7; DR UNIPROT: B2R4R3; DR UNIPROT: B4DPS4; DR UNIPROT: D3DUK2; DR UNIPROT: Q7Z6F3; DR Pfam: PF10190; DR DisGeNET: 124491; DE Function: Acts as a regulator of endoplasmic reticulum (ER) and nuclear envelope (NE) morphogenesis. Affects the ratio between tubular ER and ER sheets by promoting sheet formation at the expense of tubules. Influences NE expansion, nuclear pore complex formation and proper localization of inner nuclear membrane proteins (PubMed:26906412). {ECO:0000269|PubMed:26906412}. DE Reference Proteome: Yes; GO GO:0005789; GO GO:0016021; GO GO:0005635; GO GO:0071786; GO GO:0006998; GO GO:0051292; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MEREGSGGSGGSAGLLQQILSLKVVPRVGNGTLCPNSTSLCSFPEMWYGVFLWALVSSLFFHVPAGLLALFTLRHHKYGR SQ FMSVSILLMGIVGPITAGILTSAAIAGVYRAAGKEMIPFEALTLGTGQTFCVLVVSFLRILATL //