ID Q8WY41; PN Nanos homolog 1; GN NANOS1; OS 9606; SL Nucleus Position: SL-0198; SL Comments: Cytoplasm, perinuclear region {ECO:0000269|PubMed:12690449, ECO:0000269|PubMed:17047063, ECO:0000269|PubMed:19168546}. Cytoplasm {ECO:0000269|PubMed:12690449, ECO:0000269|PubMed:17047063, ECO:0000269|PubMed:19168546}. Note=Colocalizes with SNAPIN and PUM2 in the perinuclear region of germ cells. {ECO:0000269|PubMed:12690449, ECO:0000269|PubMed:19168546}. DR UNIPROT: Q8WY41; DR PDB: 4CQO; DR Pfam: PF05741; DR PROSITE: PS51522; DR OMIM: 608226; DR OMIM: 615413; DR DisGeNET: 340719; DE Function: May act as a translational repressor which regulates translation of specific mRNAs by forming a complex with PUM2 that associates with the 3'-UTR of mRNA targets. Capable of interfering with the proadhesive and anti-invasive functions of E-cadherin. Up-regulates the production of MMP14 to promote tumor cell invasion. {ECO:0000269|PubMed:17047063, ECO:0000269|PubMed:18223680}. DE Disease: Spermatogenic failure 12 (SPGF12) [MIM:615413]: An infertility disorder caused by spermatogenesis defects. It results in decreased sperm motility, concentration, and multiple sperm structural defects. Non-obstructive azoospermia, oligozoospermia and oligo-astheno- teratozoospermia are features observed in SPGF12 patients. {ECO:0000269|PubMed:23315541}. Note=The disease is caused by variants affecting the gene represented in this entry. DE Reference Proteome: Yes; DE Interaction: O60716; IntAct: EBI-9639078; Score: 0.52 GO GO:0005737; GO GO:0048471; GO GO:0003729; GO GO:0030371; GO GO:0008270; GO GO:0016477; GO GO:0098749; GO GO:0010631; GO GO:0017148; GO GO:0048477; GO GO:1900153; GO GO:0010608; GO GO:0001558; GO GO:0001894; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MEAFPWAPRSPRRGRAPPPMALVPSARYVSAPGPAHPQPFSSWNDYLGLATLITKAVDGEPRFGCARGGNGGGGSPPSSS SQ SSSCCSPHTGAGPGALGPALGPPDYDEDDDDDSDEPGSRGRYLGSALELRALELCAGPAEAGLLEERFAELSPFAGRAAA SQ VLLGCAPAAAAAATTTSEATPREERAPAWAAEPRLHAASGAAAARLLKPELQVCVFCRNNKEAMALYTTHILKGPDGRVL SQ CPVLRRYTCPLCGASGDNAHTIKYCPLSKVPPPPARPPPRSARDGPPGKKLR //