ID Q90ZZ5; PN Nanos homolog 1; GN nanos1; OS 8354; SL Nucleus Position: SL-0198; SL Comments: Cytoplasm {ECO:0000250}. Cytoplasm, perinuclear region {ECO:0000250}. Note=During early cleavage and blastula stages found close to the cell periphery in a germ plasm-like pattern. From gastrula stage on, detected predominantly in a perinuclear region (By similarity). {ECO:0000250}. DR UNIPROT: Q90ZZ5; DR Pfam: PF05741; DR PROSITE: PS51522; DE Function: Acts as a translational repressor. Can mediate repression affecting different steps in the translation process: cap-driven, IRES- driven, polyadenylated RNAs or nonpolyadenylated RNAs. Essential for the development of primordial germ cells (PGCs) by ensuring their proper migration and survival (By similarity). {ECO:0000250}. DE Reference Proteome: No; GO GO:0005737; GO GO:0060293; GO GO:0048471; GO GO:0003723; GO GO:0030371; GO GO:0008270; GO GO:0007281; GO GO:0008354; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MDGGLCFDSWSDYLGLSSLISRGLQPRGEGENPSPRWNVSCPAPAEPLPSKEPEGRGYKGCGFCRSNKEAMSLYSSHRLR SQ SLDGRVLCPVLRGYTCPLCGANGDWAHTMRYCPLRQLLRNPQSPRNGQ //