ID Q91836; PN Interferon-inducible double-stranded RNA-dependent protein kinase activator A homolog B; GN prkra; OS 8355; SL Nucleus Position: SL-0198; SL Comments: Cytoplasm, perinuclear region {ECO:0000250}. Nucleus {ECO:0000269|PubMed:9230068}. Nucleus, nucleolus {ECO:0000269|PubMed:9230068}. DR UNIPROT: Q91836; DR PDB: 1DI2; DR Pfam: PF00035; DR Pfam: PF16482; DR PROSITE: PS50137; DE Function: Activates eif2ak2/pkr in the absence of double-stranded RNA (dsRNA), leading to phosphorylation of eif2s1/efi2-alpha and inhibition of translation and induction of apoptosis. Required for siRNA production by dicer1 and for subsequent siRNA-mediated post- transcriptional gene silencing. Does not seem to be required for processing of pre-miRNA to miRNA by dicer1 (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; GO GO:0005737; GO GO:0005730; GO GO:0048471; GO GO:0003725; GO GO:0008047; GO GO:0030422; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MSSEKPTSLNAMRATNPCETPIQLLHEFGTKTGNHPVYTLEKAEGQAHNPSFTFRLVIGDITSLGEGPSKKTPKQKAAEF SQ ALNILRGDTSKCLPVTDTLRDPKKPPNQMQENPVGSLQELAVQKGWRLPEYTVAQESGPPHKREFTITCRVETFVETGSG SQ TSKQVAKRVAAEKLLTKFKTISTDNIPLNKLIGNKMGCTWDSMRNSSGEKISMLKRSPLSIPNTDYVKMLKDVAEELDFN SQ LTYLDIDELSVNGQYQCLAELSTNPITVCHGTGISCGNAHNDAAHNALQYLKIMCIKK //