ID Q91WB2; PN Inactive phospholipid phosphatase 7; GN Plpp7; OS 10090; SL Nucleus Position: SL-0178; SL Comments: Nucleus envelope. Endoplasmic reticulum membrane. Membrane; Multi-pass membrane protein. Note=Both the N- and C-terminal are exposed to the cytoplasm/nucleoplasm. DR UNIPROT: Q91WB2; DR Pfam: PF01569; DE Function: Plays a role as negative regulator of myoblast differentiation, in part through effects on MTOR signaling. Has no detectable enzymatic activity. Knockdown in myoblasts strongly promotes differentiation, whereas overexpression represses myogenesis. {ECO:0000269|PubMed:19704009}. DE Reference Proteome: Yes; GO GO:0005789; GO GO:0016021; GO GO:0016020; GO GO:0005635; GO GO:0042392; GO GO:0010832; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MPASQSRARARDRNNVLNRAEFLSLNQPPKGTQEPRSSGRKASGPSTQPPPSSDGARERRQSQQLPEEDCMQLNPSFKGI SQ AFNSLLAIDICMSKRLGVCAGRAASWASARSMVKLIGITGHGIPWIGGTILCLVRSSTLAGQEVLMNLLLALLLDIMTVA SQ GVQKLIKRRGPYETSPGLLDYLTMDIYAFPAGHASRAAMVSKFFLSHLVLAVPLRVLLVLWAFCVGLSRVMIGRHHITDV SQ ISGFIIGYFQFRLVELVWMSSNTCQMLISAW //