ID Q91WS2; PN NACHT, LRR and PYD domains-containing protein 6; GN Nlrp6; OS 10090; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Comments: Cytoplasm {ECO:0000250|UniProtKB:Q63035}. Inflammasome {ECO:0000269|PubMed:30248149, ECO:0000269|PubMed:34678144}. [Isoform 1]: Cytoplasm {ECO:0000250|UniProtKB:Q63035}. Inflammasome {ECO:0000250|UniProtKB:P59044}. Cell membrane {ECO:0000250|UniProtKB:Q63035}. Nucleus membrane {ECO:0000250|UniProtKB:Q63035}. [Isoform 2]: Cytoplasm {ECO:0000250|UniProtKB:Q63035}. Cell membrane {ECO:0000250|UniProtKB:Q63035}. Note=Predominantly expressed in the cell membrane. {ECO:0000250|UniProtKB:Q63035}. DR UNIPROT: Q91WS2; DR UNIPROT: C9W978; DR UNIPROT: F8UKQ6; DR UNIPROT: Q67EY0; DR UNIPROT: Q8K0L4; DR Pfam: PF05729; DR Pfam: PF17776; DR Pfam: PF17779; DR Pfam: PF02758; DR PROSITE: PS50824; DR PROSITE: PS50837; DE Function: Acts as the sensor component of the NLRP6 inflammasome, which mediates inflammasome activation in response to various pathogen- associated signals, leading to maturation and secretion of IL1B and IL18 (PubMed:21593405, PubMed:30392956, PubMed:32424362, PubMed:34678144). Inflammasomes are supramolecular complexes that assemble in the cytosol in response to pathogens and other damage- associated signals and play critical roles in innate immunity and inflammation (PubMed:30392956). Acts as a recognition receptor (PRR): recognizes and binds specific pathogens and other damage-associated signals, such as lipoteichoic acid (LTA), a cell-wall component of Gram-positive bacteria, or double stranded RNA (dsRNA) (PubMed:26494172, PubMed:30392956, PubMed:34678144). May also recognize and bind lipopolysaccharide (LPS), a major component of the outer membrane of Gram-negative bacteria; however, LPS is probably not a major activator of the NLRP6 inflammasome (PubMed:34678144). Following LTA- or dsRNA-binding, NLRP6 undergoes liquid-liquid phase separation (LLPS), enhancing multivalent interactions, an essential step for the formation of the NLRP6 inflammasome polymeric complex (PubMed:34678144). The NLRP6 inflammasome acts by promoting recruitment of effector pro-inflammatory caspases (CASP1 and/or CASP4) that catalyze maturation and secretion of IL1B and IL18 in the extracellular milieu (PubMed:30392956). The NLRP6 inflammasome plays a central role in the maintenance of epithelial integrity and host defense against microbial infections in the intestine (PubMed:21565393, PubMed:22763455, PubMed:23696660, PubMed:26638072, PubMed:28445725, PubMed:30392956). Required to restrict infection against Gram-positive bacteria by recognizing lipoteichoic acid (LTA), leading to recruitment of CASP4 and CASP1, and subsequent maturation and secretion of IL1B and IL18 (PubMed:30392956). Involved in intestinal antiviral innate immunity together with DHX15: recognizes and binds viral dsRNA to restrict infection by enteric viruses through the interferon pathway and GSDMD-dependent release of IL18 (PubMed:26494172, PubMed:34678144). Required to prevent infection by the apicomplexan parasite C.tyzzeri in enterocytes by promoting GSDMD-dependent release of IL18 (PubMed:33372132). The NLRP6 inflammasome may also regulate the gut microbiota composition by acting as a sensor of microbiota-associated metabolites to form a PYCARD/ASC-dependent inflammasome for downstream IL18 release and secretion of antimicrobial peptides (PubMed:21565393, PubMed:22763455, PubMed:26638072, PubMed:33617596). Its role in the regulation of the gut microbiota composition is however subject to discussion (PubMed:29281815, PubMed:29281837, PubMed:28801232). Essential for gut mucosal self-renewal and proliferation (PubMed:21593405, PubMed:21543645, PubMed:21565393). Regulate mucus secretion in an inflammasome- and autophagy-dependent manner to prevent invasion by enteric bacteria (PubMed:24581500, PubMed:27339979). During systemic bacterial infections, the NLRP6 inflammasome negatively regulates neutrophil recruitment and neutrophil extracellular traps (NETs) formation (PubMed:22763455, PubMed:30248149, PubMed:33918100, PubMed:33230225). May promote peripheral nerve recovery following injury via an inflammasome-independent mechanism (PubMed:26253422). {ECO:0000269|PubMed:21543645, ECO:0000269|PubMed:21565393, ECO:0000269|PubMed:21593405, ECO:0000269|PubMed:22763455, ECO:0000269|PubMed:23696660, ECO:0000269|PubMed:24581500, ECO:0000269|PubMed:26253422, ECO:0000269|PubMed:26494172, ECO:0000269|PubMed:26638072, ECO:0000269|PubMed:27339979, ECO:0000269|PubMed:28445725, ECO:0000269|PubMed:28801232, ECO:0000269|PubMed:29281815, ECO:0000269|PubMed:29281837, ECO:0000269|PubMed:30248149, ECO:0000269|PubMed:30392956, ECO:0000269|PubMed:32424362, ECO:0000269|PubMed:33230225, ECO:0000269|PubMed:33372132, ECO:0000269|PubMed:33617596, ECO:0000269|PubMed:33918100, ECO:0000269|PubMed:34678144}. DE Reference Proteome: Yes; DE Interaction: O35286; IntAct: EBI-16182259; Score: 0.44 DE Interaction: O43143; IntAct: EBI-16182238; Score: 0.40 DE Interaction: Q7Z434; IntAct: EBI-16182335; Score: 0.40 GO GO:0005737; GO GO:0005829; GO GO:0061702; GO GO:0140738; GO GO:0043228; GO GO:0031965; GO GO:0005886; GO GO:0005524; GO GO:0003725; GO GO:0001530; GO GO:0070891; GO GO:0140693; GO GO:0038187; GO GO:0042277; GO GO:0005000; GO GO:0097202; GO GO:0002526; GO GO:0002438; GO GO:0140374; GO GO:0050830; GO GO:0051607; GO GO:0048874; GO GO:0070266; GO GO:0070373; GO GO:0043124; GO GO:0050777; GO GO:0002862; GO GO:0032689; GO GO:0043409; GO GO:0034122; GO GO:0070946; GO GO:0140739; GO GO:0050729; GO GO:2000494; GO GO:0051260; GO GO:0070269; GO GO:0010506; GO GO:0050727; GO GO:0070255; GO GO:0009617; GO GO:0042060; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MDAAGASCSSVDAVARELLMATLEELSQEQLKRFRHKLRDAPLDGRSIPWGRLERSDAVDLVDKLIEFYEPVPAVEMTRQ SQ VLKRSDIRDVASRLKQQQLQKLGPTSVLLSVSAFKKKYREHVLRQHAKVKERNARSVKINKRFTKLLIAPGTGAVEDELL SQ GPLGEPEPERARRSDTHTFNRLFRGNDEESSQPLTVVLQGPAGIGKTMAAKKILYDWAAGKLYHSQVDFAFFMPCGELLE SQ RPGKRSLADLVLDQCPDRAWPVKRILAQPNRLLFILDGADELPTLPSSEATPCKDPLEATSGLRVLSGLLSQELLPGARL SQ LVTTRHAATGRLQGRLCSPQCAEIRGFSDKDKKKYFFKFFRDERKAERAYRFVKENETLFALCFVPFVCWIVCTVLQQQL SQ ELGRDLSRTSKTTTSVYLLFITSMLKSAGTNGPRVQGELRTLCRLAREGILDHHKAQFSEEDLEKLKLRGSQVQTIFLNK SQ KEIPGVLKTEVTYQFIDQSFQEFLAALSYLLEAERTPGTPAGGVQKLLNSDAELRGHLALTTRFLFGLLNTEGLRDIGNH SQ FGCVVPDHVKKDTLRWVQGQSHPKGPPVGAKKTAELEDIEDAEEEEEEEEDLNFGLELLYCLYETQEEDFVRQALSSLPE SQ IVLERVRLTRMDLEVLNYCVQCCPDGQALRLVSCGLVAAKEKKKKKKSLVKRLKGSQSTKKQPPVSLLRPLCETMTTPKC SQ HLSVLILSHCRLPDAVCRDLSEALKVAPALRELGLLQSRLTNTGLRLLCEGLAWPKCQVKTLRMQLPDLQEVINYLVIVL SQ QQSPVLTTLDLSGCQLPGVIVEPLCAALKHPKCSLKTLSLTSVELSENSLRDLQAVKTSKPDLSIIYSK //