ID  Q969L2;
PN  Protein MAL2;
GN  MAL2;
OS  9606;
SL  Nucleus Position: SL-0198;
SL  Comments: Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein. Endomembrane system. Cytoplasm, perinuclear region. Note=Associated with lipid rafts. In polarized epithelial cells, restricted to the apical surface. In hepatocytes, as well as in polarized hepatoma Hep-G2 cells, found in the canalicular membrane, equivalent to the apical surface, beneath the canalicular actin cytoskeleton. In non-polarized Hep-G2 cells, distributed to the perinuclear region.
DR  UNIPROT: Q969L2;
DR  UNIPROT: B2R520;
DR  UNIPROT: Q6ZMD9;
DR  Pfam: PF01284;
DR  PROSITE: PS51225;
DR  OMIM: 609684;
DR  DisGeNET: 114569;
DE  Function: Member of the machinery of polarized transport. Required for the indirect transcytotic route at the step of the egress of the transcytosing cargo from perinuclear endosomes in order for it to travel to the apical surface via a raft-dependent pathway. {ECO:0000269|PubMed:12370246}.
DE  Reference Proteome: Yes;
DE  Interaction: P55327; IntAct: EBI-944304; Score: 0.37
DE  Interaction: Q9H221; IntAct: EBI-3943706; Score: 0.37
DE  Interaction: P62136; IntAct: EBI-5564558; Score: 0.37
DE  Interaction: P43378; IntAct: EBI-10209175; Score: 0.67
DE  Interaction: P53365; IntAct: EBI-10213310; Score: 0.72
DE  Interaction: Q05329; IntAct: EBI-10223597; Score: 0.72
DE  Interaction: Q5JS98; IntAct: EBI-10244469; Score: 0.56
DE  Interaction: Q5ST30; IntAct: EBI-10244973; Score: 0.56
DE  Interaction: Q5SU16; IntAct: EBI-10245042; Score: 0.56
DE  Interaction: Q6FGM0; IntAct: EBI-10249609; Score: 0.56
DE  Interaction: Q6IQ43; IntAct: EBI-10250437; Score: 0.56
DE  Interaction: Q969Z0; IntAct: EBI-10281551; Score: 0.56
DE  Interaction: Q96AX2; IntAct: EBI-10282129; Score: 0.56
DE  Interaction: Q9BU27; IntAct: EBI-10298617; Score: 0.56
DE  Interaction: P00431; IntAct: EBI-11522771; Score: 0.56
DE  Interaction: P04819; IntAct: EBI-11522898; Score: 0.56
DE  Interaction: P32453; IntAct: EBI-11525358; Score: 0.56
DE  Interaction: P34897; IntAct: EBI-16437285; Score: 0.56
DE  Interaction: A8MRB1; IntAct: EBI-16437275; Score: 0.56
DE  Interaction: Q9ULP0; IntAct: EBI-16437265; Score: 0.72
DE  Interaction: A0A0S2Z4D9; IntAct: EBI-16437255; Score: 0.56
DE  Interaction: Q99259; IntAct: EBI-16437245; Score: 0.72
DE  Interaction: Q9BSJ6; IntAct: EBI-16437235; Score: 0.56
DE  Interaction: Q5VYK3; IntAct: EBI-24295491; Score: 0.56
DE  Interaction: Q9UKF7; IntAct: EBI-24304896; Score: 0.56
DE  Interaction: Q9UBD0; IntAct: EBI-24305130; Score: 0.56
DE  Interaction: Q8WY91; IntAct: EBI-24306725; Score: 0.56
DE  Interaction: Q96AL5; IntAct: EBI-24333526; Score: 0.56
DE  Interaction: P49638; IntAct: EBI-24344012; Score: 0.56
DE  Interaction: Q9Y371; IntAct: EBI-24351738; Score: 0.72
DE  Interaction: Q99961; IntAct: EBI-25252609; Score: 0.56
DE  Interaction: Q96E29; IntAct: EBI-24498551; Score: 0.56
DE  Interaction: Q9NQG6; IntAct: EBI-22732927; Score: 0.56
DE  Interaction: Q9HB07; IntAct: EBI-22734634; Score: 0.56
DE  Interaction: Q9BW92; IntAct: EBI-22733879; Score: 0.56
DE  Interaction: Q8NI60; IntAct: EBI-24373384; Score: 0.56
DE  Interaction: Q9UGP5; IntAct: EBI-25265360; Score: 0.56
DE  Interaction: Q9H6H4; IntAct: EBI-24686147; Score: 0.56
DE  Interaction: O15342; IntAct: EBI-24696156; Score: 0.56
DE  Interaction: Q9NQQ7; IntAct: EBI-24702032; Score: 0.56
DE  Interaction: Q8TDT2; IntAct: EBI-24712148; Score: 0.56
DE  Interaction: P08034; IntAct: EBI-24724178; Score: 0.56
DE  Interaction: Q8NET5; IntAct: EBI-23826916; Score: 0.56
DE  Interaction: P34810; IntAct: EBI-24768375; Score: 0.56
DE  Interaction: Q13520; IntAct: EBI-25275978; Score: 0.56
DE  Interaction: Q9NY72; IntAct: EBI-25279023; Score: 0.56
DE  Interaction: O95971; IntAct: EBI-24374871; Score: 0.56
DE  Interaction: Q9P2R7; IntAct: EBI-24398006; Score: 0.56
DE  Interaction: O00141; IntAct: EBI-24398525; Score: 0.56
DE  Interaction: Q6IN84; IntAct: EBI-24537360; Score: 0.56
DE  Interaction: Q96BA8; IntAct: EBI-24555371; Score: 0.56
DE  Interaction: Q3SXY8; IntAct: EBI-25171682; Score: 0.56
DE  Interaction: P15941; IntAct: EBI-24747016; Score: 0.56
DE  Interaction: Q86VR2; IntAct: EBI-24799535; Score: 0.56
DE  Interaction: Q9NUH8; IntAct: EBI-25222259; Score: 0.56
DE  Interaction: P55212; IntAct: EBI-25835921; Score: 0.56
DE  Interaction: P13473; IntAct: EBI-25874292; Score: 0.56
DE  Interaction: P13569; IntAct: EBI-27087549; Score: 0.35
GO  GO:0016324;
GO  GO:0070062;
GO  GO:0098978;
GO  GO:0098686;
GO  GO:0016021;
GO  GO:0030285;
GO  GO:0045121;
GO  GO:0048471;
GO  GO:0019911;
GO  GO:0042552;
GO  GO:0045056;
TP  Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255};
SQ  MSAGGASVPPPPNPAVSFPPPRVTLPAGPDILRTYSGAFVCLEILFGGLVWILVASSNVPLPLLQGWVMFVSVTAFFFSL
SQ  LFLGMFLSGMVAQIDANWNFLDFAYHFTVFVFYFGAFLLEAAATSLHDLHCNTTITGQPLLSDNQYNINVAASIFAFMTT
SQ  ACYGCSLGLALRRWRP
//