ID Q96A70; PN Antizyme inhibitor 2; GN AZIN2; OS 9606; SL Nucleus Position: SL-0198; SL Comments: Nucleus. Cytoplasm {ECO:0000250}. Cytoplasm, perinuclear region. Membrane {ECO:0000250}. Cytoplasmic vesicle. Endoplasmic reticulum-Golgi intermediate compartment {ECO:0000250}. Golgi apparatus, cis-Golgi network {ECO:0000250}. Golgi apparatus, trans-Golgi network. Cytoplasmic granule. Cell projection, axon. Cell projection, dendrite. Perikaryon. Note=Colocalizes with KDEL receptors in ER-Golgi intermediate compartment (ERGIC). Translocates from the ERGIC structure to the cytoplasm in an antizyme-dependent manner. Localizes with vesicle-associated membrane protein VAMP8 in the vicinity of the plasma membrane within serotonin-containing secretory granules (By similarity). Detected as vesicle-like pattern in neurite outgrowths. Localizes to the vesicular compartments of the secretory pathway, predominantly in the trans-Golgi network (TGN). Localizes with vesicle-associated membrane protein VAMP8 in the vicinity of the plasma membrane within serotonin-containing secretory granules. {ECO:0000250}. DR UNIPROT: Q96A70; DR UNIPROT: B2RDU5; DR UNIPROT: D3DPQ9; DR UNIPROT: Q5TIF4; DR UNIPROT: Q5TIF5; DR UNIPROT: Q5TIF6; DR UNIPROT: Q8TF56; DR UNIPROT: Q96L54; DR UNIPROT: Q96L55; DR UNIPROT: Q96L56; DR UNIPROT: Q96L57; DR UNIPROT: Q96MD9; DR Pfam: PF02784; DR Pfam: PF00278; DR PROSITE: PS00878; DR PROSITE: PS00879; DR OMIM: 608353; DR DisGeNET: 113451; DE Function: Antizyme inhibitor (AZI) protein that positively regulates ornithine decarboxylase (ODC) activity and polyamine uptake. AZI is an enzymatically inactive ODC homolog that counteracts the negative effect of ODC antizymes (AZs) OAZ1, OAZ2 and OAZ3 on ODC activity by competing with ODC for antizyme-binding (PubMed:17900240). Inhibits antizyme- dependent ODC degradation and releases ODC monomers from their inactive complex with antizymes, leading to formation of the catalytically active ODC homodimer and restoring polyamine production (PubMed:17900240). Participates in the morphological integrity of the trans-Golgi network (TGN) and functions as a regulator of intracellular secretory vesicle trafficking (PubMed:20188728). {ECO:0000269|PubMed:17900240, ECO:0000269|PubMed:20188728}. DE Reference Proteome: Yes; DE Interaction: Q9UMX2; IntAct: EBI-10281607; Score: 0.56 DE Interaction: Q9NZC9; IntAct: EBI-21811703; Score: 0.35 DE Interaction: Q96FC9; IntAct: EBI-21811703; Score: 0.35 DE Interaction: Q8ND04; IntAct: EBI-21811703; Score: 0.35 DE Interaction: Q5T3J3; IntAct: EBI-21811703; Score: 0.35 DE Interaction: Q16890; IntAct: EBI-21811703; Score: 0.35 DE Interaction: P78395; IntAct: EBI-21811703; Score: 0.35 DE Interaction: P57737; IntAct: EBI-21811703; Score: 0.35 DE Interaction: P54368; IntAct: EBI-21811703; Score: 0.35 DE Interaction: O95190; IntAct: EBI-21811703; Score: 0.35 GO GO:0030424; GO GO:0005801; GO GO:0005737; GO GO:0031410; GO GO:0005829; GO GO:0030425; GO GO:0033116; GO GO:1990005; GO GO:0005739; GO GO:0005634; GO GO:0043204; GO GO:0048471; GO GO:0005802; GO GO:0030133; GO GO:0008792; GO GO:0042978; GO GO:0097055; GO GO:0042177; GO GO:0043085; GO GO:1902269; GO GO:0033387; GO GO:0007283; GO GO:0098629; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MAGYLSESDFVMVEEGFSTRDLLKELTLGASQATTDEVAAFFVADLGAIVRKHFCFLKCLPRVRPFYAVKCNSSPGVLKV SQ LAQLGLGFSCANKAEMELVQHIGIPASKIICANPCKQIAQIKYAAKHGIQLLSFDNEMELAKVVKSHPSAKMVLCIATDD SQ SHSLSCLSLKFGVSLKSCRHLLENAKKHHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGHKMHVLDLGGGFP SQ GTEGAKVRFEEIASVINSALDLYFPEGCGVDIFAELGRYYVTSAFTVAVSIIAKKEVLLDQPGREEENGSTSKTIVYHLD SQ EGVYGIFNSVLFDNICPTPILQKKPSTEQPLYSSSLWGPAVDGCDCVAEGLWLPQLHVGDWLVFDNMGAYTVGMGSPFWG SQ TQACHITYAMSRVAWEALRRQLMAAEQEDDVEGVCKPLSCGWEITDTLCVGPVFTPASIM //