ID  Q96CV9;
PN  Optineurin;
GN  OPTN;
OS  9606;
SL  Nucleus Position: SL-0198;
SL  Comments: Cytoplasm, perinuclear region. Golgi apparatus {ECO:0000269|PubMed:27534431, ECO:0000269|PubMed:27538435}. Golgi apparatus, trans-Golgi network. Cytoplasmic vesicle, autophagosome. Cytoplasmic vesicle. Recycling endosome. Note=Found in the perinuclear region and associates with the Golgi apparatus (PubMed:27534431). Colocalizes with MYO6 and RAB8 at the Golgi complex and in vesicular structures close to the plasma membrane. Localizes to LC3-positive cytoplasmic vesicles upon induction of autophagy. {ECO:0000269|PubMed:27534431}.
DR  UNIPROT: Q96CV9;
DR  UNIPROT: B3KP00;
DR  UNIPROT: D3DRS4;
DR  UNIPROT: D3DRS8;
DR  UNIPROT: Q5T672;
DR  UNIPROT: Q5T673;
DR  UNIPROT: Q5T674;
DR  UNIPROT: Q5T675;
DR  UNIPROT: Q7LDL9;
DR  UNIPROT: Q8N562;
DR  UNIPROT: Q9UET9;
DR  UNIPROT: Q9UEV4;
DR  UNIPROT: Q9Y218;
DR  PDB: 2LO4;
DR  PDB: 2LUE;
DR  PDB: 3VTV;
DR  PDB: 3VTW;
DR  PDB: 5AAZ;
DR  PDB: 5B83;
DR  PDB: 5EOA;
DR  PDB: 5EOF;
DR  PDB: 7CZM;
DR  Pfam: PF16516;
DR  Pfam: PF11577;
DR  PROSITE: PS51801;
DR  OMIM: 137760;
DR  OMIM: 602432;
DR  OMIM: 606657;
DR  OMIM: 613435;
DR  DisGeNET: 10133;
DE  Function: Plays an important role in the maintenance of the Golgi complex, in membrane trafficking, in exocytosis, through its interaction with myosin VI and Rab8 (PubMed:27534431). Links myosin VI to the Golgi complex and plays an important role in Golgi ribbon formation (PubMed:27534431). Plays a role in the activation of innate immune response during viral infection. Mechanistically, recruits TBK1 at the Golgi apparatus, promoting its trans-phosphorylation after RLR or TLR3 stimulation (PubMed:27538435). In turn, activated TBK1 phosphorylates its downstream partner IRF3 to produce IFN-beta. Plays a neuroprotective role in the eye and optic nerve. May act by regulating membrane trafficking and cellular morphogenesis via a complex that contains Rab8 and hungtingtin (HD). Mediates the interaction of Rab8 with the probable GTPase-activating protein TBC1D17 during Rab8- mediated endocytic trafficking, such as of transferrin receptor (TFRC/TfR); regulates Rab8 recruitment to tubules emanating from the endocytic recycling compartment. Autophagy receptor that interacts directly with both the cargo to become degraded and an autophagy modifier of the MAP1 LC3 family; targets ubiquitin-coated bacteria (xenophagy), such as cytoplasmic Salmonella enterica, and appears to function in the same pathway as SQSTM1 and CALCOCO2/NDP52. {ECO:0000269|PubMed:11834836, ECO:0000269|PubMed:15837803, ECO:0000269|PubMed:20085643, ECO:0000269|PubMed:20174559, ECO:0000269|PubMed:21617041, ECO:0000269|PubMed:22854040, ECO:0000269|PubMed:27534431, ECO:0000269|PubMed:27538435}. (Microbial infection) May constitute a cellular target for adenovirus E3 14.7 and Bluetongue virus protein NS3 to inhibit innate immune response. {ECO:0000269|PubMed:27538435, ECO:0000269|PubMed:9488477}.
DE  Disease: Glaucoma 1, open angle, E (GLC1E) [MIM:137760]: A form of primary open angle glaucoma (POAG). POAG is characterized by a specific pattern of optic nerve and visual field defects. The angle of the anterior chamber of the eye is open, and usually the intraocular pressure is increased. However, glaucoma can occur at any intraocular pressure. The disease is generally asymptomatic until the late stages, by which time significant and irreversible optic nerve damage has already taken place. {ECO:0000269|PubMed:11834836, ECO:0000269|PubMed:12939304, ECO:0000269|PubMed:14597044, ECO:0000269|PubMed:15226658, ECO:0000269|PubMed:15326130, ECO:0000269|PubMed:15557444, ECO:0000269|PubMed:17389490, ECO:0000269|PubMed:20085643, ECO:0000269|PubMed:22854040, ECO:0000269|PubMed:23669351, ECO:0000269|PubMed:24752605}. Note=The disease is caused by variants affecting the gene represented in this entry. Glaucoma, normal pressure (NPG) [MIM:606657]: A primary glaucoma characterized by intraocular pression consistently within the statistically normal population range. {ECO:0000269|PubMed:15370540}. Note=Disease susceptibility is associated with variants affecting the gene represented in this entry. Amyotrophic lateral sclerosis 12 with or without frontotemporal dementia (ALS12) [MIM:613435]: A form of amyotrophic lateral sclerosis, a neurodegenerative disorder affecting upper motor neurons in the brain and lower motor neurons in the brain stem and spinal cord, resulting in fatal paralysis. Sensory abnormalities are absent. The pathologic hallmarks of the disease include pallor of the corticospinal tract due to loss of motor neurons, presence of ubiquitin-positive inclusions within surviving motor neurons, and deposition of pathologic aggregates. The etiology of amyotrophic lateral sclerosis is likely to be multifactorial, involving both genetic and environmental factors. The disease is inherited in 5-10% of the cases. ALS12 inheritance can be autosomal dominant or autosomal recessive. There is also sporadic occurrence. ALS12 patients may develop frontotemporal dementia. {ECO:0000269|PubMed:20428114, ECO:0000269|PubMed:27534431}. Note=The disease is caused by variants affecting the gene represented in this entry.
DE  Reference Proteome: Yes;
DE  Interaction: O14656; IntAct: EBI-25847280; Score: 0.56
DE  Interaction: O60711; IntAct: EBI-25910777; Score: 0.56
DE  Interaction: O75604; IntAct: EBI-24491151; Score: 0.56
DE  Interaction: P14335; IntAct: EBI-11423434; Score: 0.37
DE  Interaction: P61026; IntAct: EBI-10218281; Score: 0.56
DE  Interaction: Q03001; IntAct: EBI-5357450; Score: 0.45
DE  Interaction: Q13023; IntAct: EBI-5357521; Score: 0.45
DE  Interaction: Q29122; IntAct: EBI-15804564; Score: 0.60
DE  Interaction: Q8IZQ1; IntAct: EBI-25910907; Score: 0.56
DE  Interaction: Q8N205; IntAct: EBI-25911446; Score: 0.56
DE  Interaction: Q8N3K9; IntAct: EBI-5662034; Score: 0.00
DE  Interaction: P42858; IntAct: EBI-7473268; Score: 0.82
DE  Interaction: P61007; IntAct: EBI-7473283; Score: 0.53
DE  Interaction: Q9Y3C5; IntAct: EBI-7220058; Score: 0.37
DE  Interaction: Q9Y3C0; IntAct: EBI-756949; Score: 0.95
DE  Interaction: Q9HA65; IntAct: EBI-759844; Score: 0.74
DE  Interaction: Q9UHD2; IntAct: EBI-7821337; Score: 0.90
DE  Interaction: Q8TBZ3; IntAct: EBI-2515515; Score: 0.40
DE  Interaction: P0CK53; IntAct: EBI-2622646; Score: 0.37
DE  Interaction: Q9UPN3; IntAct: EBI-2682283; Score: 0.00
DE  Interaction: Q96NC0; IntAct: EBI-25911422; Score: 0.68
DE  Interaction: P38646; IntAct: EBI-2682326; Score: 0.00
DE  Interaction: P78344; IntAct: EBI-2682339; Score: 0.00
DE  Interaction: P07199; IntAct: EBI-2682313; Score: 0.00
DE  Interaction: Q8N183; IntAct: EBI-2682370; Score: 0.00
DE  Interaction: O95197; IntAct: EBI-2682352; Score: 0.00
DE  Interaction: Q96PV0; IntAct: EBI-2682383; Score: 0.00
DE  Interaction: Q99848; IntAct: EBI-2682431; Score: 0.00
DE  Interaction: Q15018; IntAct: EBI-2682444; Score: 0.00
DE  Interaction: P37231; IntAct: EBI-2684672; Score: 0.00
DE  Interaction: O14949; IntAct: EBI-2690962; Score: 0.00
DE  Interaction: Q8IX21; IntAct: EBI-2690975; Score: 0.00
DE  Interaction: P61513; IntAct: EBI-2690988; Score: 0.00
DE  Interaction: P84996; IntAct: EBI-2691001; Score: 0.00
DE  Interaction: Q15884; IntAct: EBI-8636651; Score: 0.37
DE  Interaction: Q8N448; IntAct: EBI-8638727; Score: 0.67
DE  Interaction: Q9UJX2; IntAct: EBI-8638780; Score: 0.79
DE  Interaction: Q15025; IntAct: EBI-8638815; Score: 0.96
DE  Interaction: Q8N2W9; IntAct: EBI-3941509; Score: 0.37
DE  Interaction: P20929; IntAct: EBI-5357463; Score: 0.27
DE  Interaction: Q14BN4; IntAct: EBI-5357483; Score: 0.45
DE  Interaction: P04275; IntAct: EBI-5357436; Score: 0.45
DE  Interaction: Q9UNH7; IntAct: EBI-5357503; Score: 0.45
DE  Interaction: O75923; IntAct: EBI-5357074; Score: 0.50
DE  Interaction: Q8WZ42; IntAct: EBI-5357536; Score: 0.45
DE  Interaction: A0AUZ9; IntAct: EBI-5661999; Score: 0.00
DE  Interaction: Q00610; IntAct: EBI-5662016; Score: 0.00
DE  Interaction: Q86YF9; IntAct: EBI-5662068; Score: 0.00
DE  Interaction: P02794; IntAct: EBI-5662086; Score: 0.00
DE  Interaction: P11055; IntAct: EBI-5662103; Score: 0.00
DE  Interaction: Q96CV9; IntAct: EBI-10486995; Score: 0.93
DE  Interaction: P0CG47; IntAct: EBI-5662277; Score: 0.00
DE  Interaction: P0CG48; IntAct: EBI-5662311; Score: 0.00
DE  Interaction: P55072; IntAct: EBI-5662328; Score: 0.00
DE  Interaction: Q2M3W8; IntAct: EBI-5662362; Score: 0.00
DE  Interaction: Q9NR11; IntAct: EBI-25911097; Score: 0.56
DE  Interaction: Q9BUY5; IntAct: EBI-24531605; Score: 0.67
DE  Interaction: Q9Y462; IntAct: EBI-5662416; Score: 0.00
DE  Interaction: P63104; IntAct: EBI-6115969; Score: 0.35
DE  Interaction: Q04917; IntAct: EBI-6115969; Score: 0.35
DE  Interaction: P27348; IntAct: EBI-6115969; Score: 0.35
DE  Interaction: P31946; IntAct: EBI-6115969; Score: 0.35
DE  Interaction: Q8TF68; IntAct: EBI-6115969; Score: 0.35
DE  Interaction: P61981; IntAct: EBI-6115969; Score: 0.35
DE  Interaction: Q9GZV4; IntAct: EBI-6115969; Score: 0.35
DE  Interaction: Q9NZW5; IntAct: EBI-6115969; Score: 0.35
DE  Interaction: Q00013; IntAct: EBI-6115969; Score: 0.50
DE  Interaction: Q8N5Z5; IntAct: EBI-6115969; Score: 0.35
DE  Interaction: P04792; IntAct: EBI-6873662; Score: 0.37
DE  Interaction: Q99IB8; IntAct: EBI-6929183; Score: 0.49
DE  Interaction: Q8IUH5; IntAct: EBI-9091427; Score: 0.51
DE  Interaction: P61006; IntAct: EBI-9636359; Score: 0.63
DE  Interaction: Q8IYU2; IntAct: EBI-9692526; Score: 0.69
DE  Interaction: Q9GZQ8; IntAct: EBI-9686007; Score: 0.40
DE  Interaction: Q13501; IntAct: EBI-9683643; Score: 0.56
DE  Interaction: P62991; IntAct: EBI-9683699; Score: 0.35
DE  Interaction: P54845; IntAct: EBI-9819121; Score: 0.59
DE  Interaction: Q15038; IntAct: EBI-10235566; Score: 0.72
DE  Interaction: Q86UD4; IntAct: EBI-10258929; Score: 0.56
DE  Interaction: Q8TC07; IntAct: EBI-10273957; Score: 0.81
DE  Interaction: Q8TD17; IntAct: EBI-10284210; Score: 0.56
DE  Interaction: Q9BS34; IntAct: EBI-10297343; Score: 0.72
DE  Interaction: P29882; IntAct: EBI-11736184; Score: 0.37
DE  Interaction: Q8QXP6; IntAct: EBI-11423426; Score: 0.37
DE  Interaction: P01123; IntAct: EBI-11522853; Score: 0.56
DE  Interaction: P40302; IntAct: EBI-11530596; Score: 0.56
DE  Interaction: P40325; IntAct: EBI-11530772; Score: 0.56
DE  Interaction: P40454; IntAct: EBI-11531041; Score: 0.56
DE  Interaction: Q9NTZ6; IntAct: EBI-24303106; Score: 0.72
DE  Interaction: P78424; IntAct: EBI-25257980; Score: 0.56
DE  Interaction: Q12904; IntAct: EBI-24374520; Score: 0.56
DE  Interaction: Q96B67; IntAct: EBI-24377191; Score: 0.56
DE  Interaction: P17021; IntAct: EBI-24397642; Score: 0.56
DE  Interaction: Q9NWF9; IntAct: EBI-24401865; Score: 0.56
DE  Interaction: O00560; IntAct: EBI-24450679; Score: 0.56
DE  Interaction: O75031; IntAct: EBI-24454388; Score: 0.56
DE  Interaction: Q9NRD5; IntAct: EBI-24457528; Score: 0.56
DE  Interaction: Q8IYE1; IntAct: EBI-24553668; Score: 0.56
DE  Interaction: Q99732; IntAct: EBI-12703418; Score: 0.56
DE  Interaction: Q86Y82; IntAct: EBI-21524609; Score: 0.35
DE  Interaction: Q8TBN0; IntAct: EBI-21785841; Score: 0.35
DE  Interaction: O95789; IntAct: EBI-21819321; Score: 0.40
DE  Interaction: O95361; IntAct: EBI-21888746; Score: 0.35
DE  Interaction: Q13490; IntAct: EBI-20736936; Score: 0.35
DE  Interaction: P21580; IntAct: EBI-20737918; Score: 0.35
DE  Interaction: P0DOF2; IntAct: EBI-25607852; Score: 0.35
DE  Interaction: Q92870; IntAct: EBI-25831379; Score: 0.56
DE  Interaction: P50570; IntAct: EBI-25844868; Score: 0.56
DE  Interaction: P49821; IntAct: EBI-25876451; Score: 0.56
DE  Interaction: O76024; IntAct: EBI-25897979; Score: 0.56
DE  Interaction: Q96GM5; IntAct: EBI-25910593; Score: 0.56
DE  Interaction: Q92185; IntAct: EBI-25910585; Score: 0.56
DE  Interaction: P23297; IntAct: EBI-25910577; Score: 0.56
DE  Interaction: Q99942; IntAct: EBI-25910569; Score: 0.56
DE  Interaction: P10276; IntAct: EBI-25910561; Score: 0.56
DE  Interaction: Q13702; IntAct: EBI-25910553; Score: 0.56
DE  Interaction: P52306; IntAct: EBI-25910545; Score: 0.56
DE  Interaction: P35998; IntAct: EBI-25910532; Score: 0.56
DE  Interaction: P07225; IntAct: EBI-25910524; Score: 0.56
DE  Interaction: P55058; IntAct: EBI-25910516; Score: 0.56
DE  Interaction: Q08499; IntAct: EBI-25910508; Score: 0.56
DE  Interaction: P51582; IntAct: EBI-25910500; Score: 0.56
DE  Interaction: P51608; IntAct: EBI-25910492; Score: 0.56
DE  Interaction: Q15797; IntAct: EBI-25910484; Score: 0.56
DE  Interaction: Q14847; IntAct: EBI-25910466; Score: 0.56
DE  Interaction: Q13123; IntAct: EBI-25910458; Score: 0.56
DE  Interaction: Q02556; IntAct: EBI-25910450; Score: 0.56
DE  Interaction: P28566; IntAct: EBI-25910442; Score: 0.56
DE  Interaction: A0A1C3PI11; IntAct: EBI-25910434; Score: 0.56
DE  Interaction: P04440; IntAct: EBI-25910410; Score: 0.56
DE  Interaction: P10074; IntAct: EBI-25910402; Score: 0.56
DE  Interaction: Q8N1C3; IntAct: EBI-25910394; Score: 0.56
DE  Interaction: Q14894; IntAct: EBI-25910386; Score: 0.56
DE  Interaction: P15169; IntAct: EBI-25910378; Score: 0.56
DE  Interaction: P23528; IntAct: EBI-25910360; Score: 0.56
DE  Interaction: P49450; IntAct: EBI-25910352; Score: 0.56
DE  Interaction: Q9Y5L3; IntAct: EBI-25910344; Score: 0.56
DE  Interaction: P07384; IntAct: EBI-25910336; Score: 0.56
DE  Interaction: O15392; IntAct: EBI-25910328; Score: 0.56
DE  Interaction: P08758; IntAct: EBI-25910320; Score: 0.56
DE  Interaction: P24666; IntAct: EBI-25910312; Score: 0.56
DE  Interaction: P26639; IntAct: EBI-25910610; Score: 0.56
DE  Interaction: Q96PU8; IntAct: EBI-25910793; Score: 0.56
DE  Interaction: Q5VZL5; IntAct: EBI-25910767; Score: 0.56
DE  Interaction: O95340; IntAct: EBI-25910759; Score: 0.56
DE  Interaction: Q9P2R7; IntAct: EBI-25910751; Score: 0.56
DE  Interaction: O95671; IntAct: EBI-25910743; Score: 0.56
DE  Interaction: A2RRN7; IntAct: EBI-25910735; Score: 0.56
DE  Interaction: Q9BUB5; IntAct: EBI-25910717; Score: 0.56
DE  Interaction: O00203; IntAct: EBI-25910709; Score: 0.56
DE  Interaction: Q9Y6Q9; IntAct: EBI-25910701; Score: 0.56
DE  Interaction: O95872; IntAct: EBI-25910693; Score: 0.56
DE  Interaction: Q9ULX5; IntAct: EBI-25910685; Score: 0.56
DE  Interaction: P17029; IntAct: EBI-25910677; Score: 0.56
DE  Interaction: O43829; IntAct: EBI-25910669; Score: 0.56
DE  Interaction: P18206; IntAct: EBI-25910661; Score: 0.56
DE  Interaction: P49459; IntAct: EBI-25910653; Score: 0.56
DE  Interaction: P52888; IntAct: EBI-25910644; Score: 0.56
DE  Interaction: P54274; IntAct: EBI-25910636; Score: 0.56
DE  Interaction: P28347; IntAct: EBI-25910628; Score: 0.56
DE  Interaction: O60927; IntAct: EBI-25910620; Score: 0.56
DE  Interaction: Q13586; IntAct: EBI-25910602; Score: 0.56
DE  Interaction: Q9NSI6; IntAct: EBI-25911013; Score: 0.56
DE  Interaction: Q9Y574; IntAct: EBI-25911005; Score: 0.56
DE  Interaction: Q9Y221; IntAct: EBI-25910992; Score: 0.56
DE  Interaction: Q8WXF7; IntAct: EBI-25910984; Score: 0.56
DE  Interaction: O15195; IntAct: EBI-25910974; Score: 0.56
DE  Interaction: Q9NY26; IntAct: EBI-25910965; Score: 0.56
DE  Interaction: Q9UBT3; IntAct: EBI-25910957; Score: 0.56
DE  Interaction: Q96G97; IntAct: EBI-25910949; Score: 0.56
DE  Interaction: Q96EZ4; IntAct: EBI-25910941; Score: 0.56
DE  Interaction: Q53HV7; IntAct: EBI-25910933; Score: 0.56
DE  Interaction: Q9UDX5; IntAct: EBI-25910925; Score: 0.56
DE  Interaction: Q9Y2X9; IntAct: EBI-25910917; Score: 0.56
DE  Interaction: Q13573; IntAct: EBI-25910899; Score: 0.56
DE  Interaction: Q9UQ53; IntAct: EBI-25910889; Score: 0.56
DE  Interaction: Q9BV73; IntAct: EBI-25910879; Score: 0.56
DE  Interaction: P78410; IntAct: EBI-25910869; Score: 0.56
DE  Interaction: Q8IVL6; IntAct: EBI-25910861; Score: 0.56
DE  Interaction: Q13113; IntAct: EBI-25910843; Score: 0.56
DE  Interaction: P50749; IntAct: EBI-25910835; Score: 0.56
DE  Interaction: P51116; IntAct: EBI-25910819; Score: 0.56
DE  Interaction: P61296; IntAct: EBI-25910811; Score: 0.56
DE  Interaction: Q9Y5Y5; IntAct: EBI-25910785; Score: 0.56
DE  Interaction: Q96HQ0; IntAct: EBI-25911233; Score: 0.56
DE  Interaction: Q6ZNA4; IntAct: EBI-25911031; Score: 0.56
DE  Interaction: Q9C0D3; IntAct: EBI-25911215; Score: 0.56
DE  Interaction: Q5VYS8; IntAct: EBI-25911207; Score: 0.56
DE  Interaction: Q9H6R3; IntAct: EBI-25911199; Score: 0.56
DE  Interaction: Q6YHU6; IntAct: EBI-25911181; Score: 0.56
DE  Interaction: Q6PCB6; IntAct: EBI-25911173; Score: 0.56
DE  Interaction: Q6ZS81; IntAct: EBI-25911165; Score: 0.56
DE  Interaction: Q9BUH8; IntAct: EBI-25911150; Score: 0.56
DE  Interaction: A4FUJ8; IntAct: EBI-25911142; Score: 0.56
DE  Interaction: Q9HBL8; IntAct: EBI-25911134; Score: 0.56
DE  Interaction: Q96G46; IntAct: EBI-25911126; Score: 0.56
DE  Interaction: Q9NRA0; IntAct: EBI-25911118; Score: 0.56
DE  Interaction: Q9UIR0; IntAct: EBI-25911110; Score: 0.56
DE  Interaction: Q9P209; IntAct: EBI-25911089; Score: 0.56
DE  Interaction: Q9NWS9; IntAct: EBI-25911081; Score: 0.56
DE  Interaction: Q8N0Y2; IntAct: EBI-25911073; Score: 0.56
DE  Interaction: Q9BWG1; IntAct: EBI-25911065; Score: 0.56
DE  Interaction: Q8N302; IntAct: EBI-25911057; Score: 0.56
DE  Interaction: Q9BUL9; IntAct: EBI-25911049; Score: 0.56
DE  Interaction: Q6NXG1; IntAct: EBI-25911041; Score: 0.56
DE  Interaction: I6L9D0; IntAct: EBI-25911225; Score: 0.56
DE  Interaction: Q6XD76; IntAct: EBI-25911341; Score: 0.56
DE  Interaction: Q71DI3; IntAct: EBI-25911349; Score: 0.56
DE  Interaction: Q96QE2; IntAct: EBI-25911323; Score: 0.56
DE  Interaction: Q9BYZ2; IntAct: EBI-25911315; Score: 0.56
DE  Interaction: Q86TI2; IntAct: EBI-25911305; Score: 0.56
DE  Interaction: Q96EF9; IntAct: EBI-25911297; Score: 0.56
DE  Interaction: Q8TDB4; IntAct: EBI-25911289; Score: 0.56
DE  Interaction: Q49A26; IntAct: EBI-25911281; Score: 0.56
DE  Interaction: Q8N5A5; IntAct: EBI-25911273; Score: 0.56
DE  Interaction: Q3KNW7; IntAct: EBI-25911265; Score: 0.56
DE  Interaction: Q969S8; IntAct: EBI-25911257; Score: 0.56
DE  Interaction: Q9BYQ4; IntAct: EBI-25911249; Score: 0.56
DE  Interaction: Q6IE81; IntAct: EBI-25911241; Score: 0.56
DE  Interaction: Q496A3; IntAct: EBI-25911454; Score: 0.56
DE  Interaction: Q86VR2; IntAct: EBI-25911438; Score: 0.56
DE  Interaction: Q96LL4; IntAct: EBI-25911430; Score: 0.56
DE  Interaction: Q8TBB0; IntAct: EBI-25911414; Score: 0.56
DE  Interaction: Q8TBE1; IntAct: EBI-25911406; Score: 0.56
DE  Interaction: Q96LX8; IntAct: EBI-25911388; Score: 0.56
DE  Interaction: Q32M92; IntAct: EBI-25911380; Score: 0.56
DE  Interaction: Q8WVJ2; IntAct: EBI-25911367; Score: 0.56
DE  Interaction: Q2NKQ1; IntAct: EBI-25911357; Score: 0.56
DE  Interaction: Q96MN9; IntAct: EBI-25911333; Score: 0.56
DE  Interaction: Q96RQ9; IntAct: EBI-25911462; Score: 0.56
DE  Interaction: Q8IXS6; IntAct: EBI-25911588; Score: 0.56
DE  Interaction: A2RU56; IntAct: EBI-25911580; Score: 0.56
DE  Interaction: Q8N1Y9; IntAct: EBI-25911570; Score: 0.56
DE  Interaction: A1A4Y4; IntAct: EBI-25911546; Score: 0.56
DE  Interaction: Q5TZF3; IntAct: EBI-25911536; Score: 0.56
DE  Interaction: Q0P5N6; IntAct: EBI-25911528; Score: 0.56
DE  Interaction: Q0P5P2; IntAct: EBI-25911520; Score: 0.56
DE  Interaction: Q96EY8; IntAct: EBI-25911512; Score: 0.56
DE  Interaction: Q9BUH6; IntAct: EBI-25911504; Score: 0.56
DE  Interaction: Q8IV33; IntAct: EBI-25911496; Score: 0.56
DE  Interaction: Q3SX64; IntAct: EBI-25911478; Score: 0.56
DE  Interaction: Q8IZS5; IntAct: EBI-25911470; Score: 0.56
DE  Interaction: Q8TB36; IntAct: EBI-25923368; Score: 0.56
DE  Interaction: Q9HAD4; IntAct: EBI-26619290; Score: 0.40
GO  GO:0005776;
GO  GO:0005737;
GO  GO:0005829;
GO  GO:0005794;
GO  GO:0000139;
GO  GO:0005654;
GO  GO:0005634;
GO  GO:0048471;
GO  GO:0055038;
GO  GO:0005802;
GO  GO:0042802;
GO  GO:0070530;
GO  GO:0046872;
GO  GO:0031593;
GO  GO:0008022;
GO  GO:0030674;
GO  GO:0031267;
GO  GO:0006914;
GO  GO:0008219;
GO  GO:0034620;
GO  GO:0050829;
GO  GO:0007030;
GO  GO:0090161;
GO  GO:0043001;
GO  GO:0045087;
GO  GO:0043124;
GO  GO:0001920;
GO  GO:0061734;
GO  GO:0010508;
GO  GO:1904417;
GO  GO:0034067;
GO  GO:0043122;
GO  GO:0007165;
TP  Membrane Topology: Unknown; Source: UniProt - Sequence Analysis;
SQ  MSHQPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQAMKGRFEELSAWTEKQK
SQ  EERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSERSSEDPTDDSRLPRAEAEQEKDQLRTQVVRLQAEKADLLGI
SQ  VSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTALSKYRSRSADGAKNYFEHEELTVSQLLLCL
SQ  REGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEGSTEKENDEEKGPETVGSEVEALNLQVTSLFKELQEAHTKL
SQ  SEAELMKKRLQEKCQALERKNSAIPSELNEKQELVYTNKKLELQVESMLSEIKMEQAKTEDEKSKLTVLQMTHNKLLQEH
SQ  NNALKTIEELTRKESEKVDRAVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERA
SQ  AREKIHEEKEQLALQLAVLLKENDAFEDGGRQSLMEMQSRHGARTSDSDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGE
SQ  VLPDIDTLQIHVMDCII
//