ID Q99N46; PN Brain protein I3; GN I3; OS 10141; SL Nucleus Position: SL-0198; SL Comments: Lysosome membrane {ECO:0000250|UniProtKB:O95415}; Multi-pass membrane protein {ECO:0000255}. Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:O95415}. Note=Co-localizes with MGAT1 and IFITM3 at the perinuclear region. {ECO:0000250|UniProtKB:O95415}. DR UNIPROT: Q99N46; DR Pfam: PF10164; DE Function: Participates in tumor necrosis factor-alpha (TNF)-induced cell death. May be a target of Wnt/beta-catenin signaling in the liver. {ECO:0000250|UniProtKB:O95415}. DE Reference Proteome: Yes; GO GO:0016021; GO GO:0005765; GO GO:0048471; GO GO:0042802; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MDHKPLLQERPPAYNLEAGQGDYACGAPGYGAIPSAPPPPPYPYLVTGIPTPHPRVYSIHSRTVTRYPANSIVVVGGCPV SQ CRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNCGATFT //