ID  Q9C9T3;
PN  Mitotic-spindle organizing protein 1A;
GN  GIP2;
OS  3702;
SL  Nucleus Position: SL-0178;
SL  Comments: Cytoplasm, cytoskeleton, microtubule organizing center {ECO:0000250|UniProtKB:Q08AG7}. Cytoplasm, cytoskeleton, spindle. Nucleus. Cytoplasm, cytoskeleton, phragmoplast. Nucleus envelope. Note=Reorganized from the nucleus to the prospindle and the preprophase band in late G2. After nuclear envelope breakdown, localized on spindle and phragmoplast microtubules (MTs) and on the reforming nuclear envelope of daughter cells. Present in mitotic microtubule arrays. In interphase cortical arrays, gamma-tubulin complexes are preferentially recruited to existing microtubules, from which new microtubules are efficiently nucleated.
DR  UNIPROT: Q9C9T3;
DR  Pfam: PF12554;
DE  Function: Required for gamma-tubulin complex recruitment to the microtubule organizing centers (MTOCs) (By similarity). During mitosis, modulates gamma-tubulin complex localization, spindle stability and chromosomal segregation. Necessary for gametophyte development and embryogenesis. {ECO:0000250}.
DE  Reference Proteome: Yes;
DE  Interaction: Q8LAZ7; IntAct: EBI-4512944; Score: 0.37
DE  Interaction: O82230; IntAct: EBI-4512952; Score: 0.37
DE  Interaction: Q56YJ8; IntAct: EBI-4512960; Score: 0.37
DE  Interaction: Q84K16; IntAct: EBI-4512968; Score: 0.37
DE  Interaction: Q8L7I1; IntAct: EBI-4512976; Score: 0.37
GO  GO:0000931;
GO  GO:0031021;
GO  GO:0005874;
GO  GO:0005635;
GO  GO:0009524;
GO  GO:0005819;
GO  GO:0042393;
GO  GO:0034080;
GO  GO:0034508;
GO  GO:0033566;
GO  GO:0051415;
GO  GO:0051418;
GO  GO:0090307;
TP  Membrane Topology: Unknown; Source: UniProt - Sequence Analysis;
SQ  MNQEAAETARESLELVFRMSNILETGLDRHTLSVLIALCDIGLNPEALATLVKELRRDSATTTTTVD
//