ID  Q9CQG9;
PN  Transmembrane protein 100;
GN  Tmem100;
OS  10090;
SL  Nucleus Position: SL-0198;
SL  Comments: Cell membrane {ECO:0000269|PubMed:23485812, ECO:0000269|PubMed:25640077}; Multi-pass membrane protein {ECO:0000269|PubMed:23485812, ECO:0000269|PubMed:25640077}. Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. Perikaryon {ECO:0000269|PubMed:23485812}. Cytoplasm, perinuclear region {ECO:0000250}. Endoplasmic reticulum {ECO:0000250}. Note=Colocalized with HSPA5 in the endoplasmic reticulum (ER). Enriched in ER microsome. Colocalized with BMP4 in neural cell bodies and neural fibers of the enteric nervous system (By similarity). {ECO:0000250}.
DR  UNIPROT: Q9CQG9;
DR  Pfam: PF16311;
DE  Function: Plays a role during embryonic arterial endothelium differentiation and vascular morphogenesis through the ACVRL1 receptor- dependent signaling pathway upon stimulation by bone morphogenetic proteins, such as GDF2/BMP9 and BMP10 (PubMed:22783020). Involved in the regulation of nociception, acting as a modulator of the interaction between TRPA1 and TRPV1, two molecular sensors and mediators of pain signals in dorsal root ganglia (DRG) neurons (PubMed:25640077). Mechanistically, it weakens their interaction, thereby releasing the inhibition of TRPA1 by TRPV1 and increasing the single-channel open probability of the TRPA1-TRPV1 complex (PubMed:25640077). {ECO:0000269|PubMed:22783020, ECO:0000269|PubMed:25640077}.
DE  Reference Proteome: Yes;
GO  GO:0005783;
GO  GO:0016021;
GO  GO:0043204;
GO  GO:0048471;
GO  GO:0005886;
GO  GO:0001525;
GO  GO:0060842;
GO  GO:0030509;
GO  GO:0071773;
GO  GO:0003197;
GO  GO:0003198;
GO  GO:0001701;
GO  GO:0007219;
GO  GO:0045603;
GO  GO:2001214;
GO  GO:0043491;
GO  GO:0050848;
GO  GO:0051930;
GO  GO:0001570;
TP  Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255};
SQ  MTEESTKENLGAPKSPTPVTMEKNPKREVVVTTGPLVSEVQLMAATGGAELSCYRCIIPFAVVVFITGIVVTAVAYSFNS
SQ  HGSIISIFGLVLLSSGLFLLASSALCWKVRQRNKKVKRRESQTALVVNQRCLFA
//