ID Q9CWU9; PN Nucleoporin Nup37; GN Nup37; OS 10090; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0185; SL Comments: Chromosome, centromere, kinetochore {ECO:0000250}. Nucleus, nuclear pore complex {ECO:0000250}. DR UNIPROT: Q9CWU9; DR UNIPROT: Q9CZ80; DR Pfam: PF00400; DR PROSITE: PS00678; DR PROSITE: PS50082; DR PROSITE: PS50294; DE Function: Component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; GO GO:0000776; GO GO:0005635; GO GO:0005643; GO GO:0031080; GO GO:0005654; GO GO:0007049; GO GO:0051301; GO GO:0007059; GO GO:0051028; GO GO:0006913; GO GO:0015031; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MKQDATRNAAYTVDCEDYVHVVEFNPFESGDSGNLIAYGGSNYVVVGMCTFQEEETDIEGIQYKTLRTFHHGVRVDGIAW SQ SPETKLDSLPPVIKFCTSAADLKIRLFTSDLQDKNEYKVLEGHSDFINDLVFHPKEGQELASVSDDHTCRIWNLEGKQTA SQ HFLLHSPGMSVCWHPEETFKLMVAEKNGTIRFYDLMAQQAILSLQSEQTPLMSAHWCLKNTFKVGAVAGNDWIIWDITRS SQ SYPQETRPVHMDRAHLFRWSAISENLFATTGYPGKMASQFQIHHLGHSQPVLIGSVAVGSGLSWHRTLPLCAVGGDHKLL SQ FWVTEI //