ID  Q9D4F2;
PN  Polyisoprenoid diphosphate/phosphate phosphohydrolase PLPP6;
GN  Plpp6;
OS  10090;
SL  Nucleus Position: SL-0178;
SL  Nucleus Position: SL-0179;
SL  Nucleus Position: SL-0182;
SL  Comments: Endoplasmic reticulum membrane {ECO:0000250|UniProtKB:Q8IY26}; Multi-pass membrane protein {ECO:0000250|UniProtKB:Q8IY26}. Nucleus envelope {ECO:0000250|UniProtKB:Q8IY26}. Nucleus inner membrane {ECO:0000250|UniProtKB:Q8IY26}.
DR  UNIPROT: Q9D4F2;
DR  Pfam: PF01569;
DE  Function: Magnesium-independent polyisoprenoid diphosphatase that catalyzes the sequential dephosphorylation of presqualene, farnesyl, geranyl and geranylgeranyl diphosphates. Functions in the innate immune response through the dephosphorylation of presqualene diphosphate which acts as a potent inhibitor of the signaling pathways contributing to polymorphonuclear neutrophils activation. May regulate the biosynthesis of cholesterol and related sterols by dephosphorylating presqualene and farnesyl diphosphate, two key intermediates in this biosynthetic pathway. May also play a role in protein prenylation by acting on farnesyl diphosphate and its derivative geranylgeranyl diphosphate, two precursors for the addition of isoprenoid anchors to membrane proteins. Has a lower activity towards phosphatidic acid (PA), but through phosphatidic acid dephosphorylation may participate in the biosynthesis of phospholipids and triacylglycerols. May also act on ceramide-1-P, lysophosphatidic acid (LPA) and sphing-4-enine 1-phosphate/sphingosine- 1-phosphate. {ECO:0000250|UniProtKB:Q8IY26}.
DE  Reference Proteome: Yes;
GO  GO:0030176;
GO  GO:0016020;
GO  GO:0005637;
GO  GO:0031965;
GO  GO:0106405;
GO  GO:0042577;
GO  GO:0052642;
GO  GO:0008195;
GO  GO:0042392;
GO  GO:0045339;
GO  GO:0033383;
GO  GO:1902247;
GO  GO:0045087;
GO  GO:0006720;
GO  GO:0046839;
GO  GO:1902565;
GO  GO:0018342;
TP  Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255};
SQ  MPSPRRTIEGRPLGSSGGSSVPGSPAHGGGSGGGRFEFQSLLNCRAGADPACARLRASDSPVHRRGSFPLAASGPAQAAP
SQ  APPPEDARMNLNPSFLGIALRSLLAIDLWLSKKLGVCAGESSAWGSVRPLMKLLEISGHGIPWLLGTLYCLLRSDSWAGR
SQ  EVLMNLLFALLLDLLLVAVIKGLVRRRRPAHNQKDMFFTLSVDRYSFPSGHATRAALVSRFILNHLVLAIPLRVLVVLWA
SQ  FVLGLSRVMLGRHNVTDVAFGFFLGYMQYSIVDYCWLSPHNVPVLFVLWNQQ
//