ID Q9DCG9; PN Multifunctional methyltransferase subunit TRM112-like protein; GN Trmt112; OS 10090; SL Nucleus Position: SL-0198; SL Comments: Nucleus, nucleoplasm {ECO:0000250|UniProtKB:Q9UI30}. Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:Q9UI30}. Note=Localizes to a polarized perinuclear structure, overlapping partially with the Golgi and lysosomes. {ECO:0000250|UniProtKB:Q9UI30}. DR UNIPROT: Q9DCG9; DR UNIPROT: Q91YP8; DR UNIPROT: Q9D1N6; DR Pfam: PF03966; DE Function: Acts as an activator of both rRNA/tRNA and protein methyltransferases (PubMed:20606008, PubMed:26797129). Together with methyltransferase BUD23, methylates the N(7) position of a guanine in 18S rRNA (By similarity). The heterodimer with HEMK2/N6AMT1 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor (PubMed:20606008, PubMed:26797129). The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5- methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species (By similarity). Together with methyltransferase THUMPD3, catalyzes the formation of N(2)- methylguanosine at position 6 in a broad range of tRNA substrates and at position 7 of tRNA(Trp) (By similarity). Involved in the pre-rRNA processing steps leading to small-subunit rRNA production (By similarity). Together with methyltransferase METTL5, specifically methylates the 6th position of adenine in position 1832 of 18S rRNA (By similarity). {ECO:0000250|UniProtKB:Q9UI30, ECO:0000269|PubMed:20606008, ECO:0000269|PubMed:26797129}. DE Reference Proteome: Yes; GO GO:0005654; GO GO:0048471; GO GO:0032991; GO GO:0046982; GO GO:0008276; GO GO:0034968; GO GO:0018364; GO GO:2000234; GO GO:0070476; GO GO:0031167; GO GO:0030488; GO GO:0002940; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MKLLTHNLLSSHVRGVGTRGFPLRLQATEVRINPVEFNPEFVARMIPKVEWAALVQAADTLNLAEVPKEPTEGYEHDETF SQ LRKMHHVLLEVDVLEGTLQCPESGRLFPISRGIPNMLLNDEETET //