ID Q9EPI6; PN NMDA receptor synaptonuclear signaling and neuronal migration factor; GN Nsmf; OS 10116; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Comments: Nucleus. Nucleus envelope. Nucleus membrane. Nucleus matrix. Cytoplasm, cell cortex. Cytoplasm, cytoskeleton. Cell membrane; Peripheral membrane protein. Cell projection, dendrite. Synapse. Synapse, synaptosome. Postsynaptic density. Membrane. Note=Found on the outside of the luteinizing-hormone-releasing hormone (LHRH) cell membrane and axons projecting from the olfactory pit and epithelium (By similarity). Associates with transcriptionally active chromatin regions. Detected at the nuclear membranes of CA1 neurons. Cortical cytoskeleton. Localized in proximal apical dendrites. Colocalizes with CABP1 in dendrites and dendritic spines. Myristoylation is a prerequisite for extranuclear localization. Translocates from dendrites to the nucleus during NMDA receptor- dependent long-term potentiation (LTP) induction of synaptic transmission at Schaffer collateral/CA1 synapses of hippocampal primary neurons and in an importin-dependent manner. {ECO:0000250}. DR UNIPROT: Q9EPI6; DR UNIPROT: Q5PPF6; DR UNIPROT: Q7TSC6; DR UNIPROT: Q7TSC8; DR UNIPROT: Q9EPI4; DR UNIPROT: Q9EPI5; DE Function: Couples NMDA-sensitive glutamate receptor signaling to the nucleus and triggers long-lasting changes in the cytoarchitecture of dendrites and spine synapse processes. Part of the cAMP response element-binding protein (CREB) shut-off signaling pathway. Stimulates outgrowth of olfactory axons and migration of gonadotropin-releasing hormone (GnRH) and luteinizing-hormone-releasing hormone (LHRH) neuronal cells. {ECO:0000269|PubMed:18303947}. DE Reference Proteome: Yes; DE Interaction: P27361; IntAct: EBI-6899704; Score: 0.56 DE Interaction: P23565; IntAct: EBI-6899892; Score: 0.57 DE Interaction: P48039; IntAct: EBI-11578061; Score: 0.00 DE Interaction: P49286; IntAct: EBI-11578707; Score: 0.00 DE Interaction: O88751; IntAct: EBI-15688794; Score: 0.59 DE Interaction: P83953; IntAct: EBI-15688896; Score: 0.40 DE Interaction: Q5XIE8; IntAct: EBI-26439741; Score: 0.35 GO GO:0070161; GO GO:0097440; GO GO:0030863; GO GO:0005737; GO GO:0030425; GO GO:0043197; GO GO:0000791; GO GO:0098978; GO GO:0016020; GO GO:0043005; GO GO:0005635; GO GO:0016363; GO GO:0031965; GO GO:0005634; GO GO:0043204; GO GO:0005886; GO GO:0098794; GO GO:0014069; GO GO:0045202; GO GO:0048306; GO GO:0071230; GO GO:0071257; GO GO:0071371; GO GO:2001224; GO GO:0035307; GO GO:0099527; GO GO:0048814; GO GO:0043523; GO GO:0048168; TP Membrane Topology: Lipid-Anchored; Source: UniProt - Experimental Evidence {ECO:0000269|PubMed:18303947}; SQ MGAAASRRRALRSEAMSSVAAKVRAARAFGEYLSQSHPENRNGADHLLADAYSGHEGSPEMQPAPHNKRRLSLVSNGRYE SQ GSISDEAVSGKTATEGPQPRVYTISREPALLPGSEAEAIELAVVKGRRQRERHPHHHSQPLRASPGSSREDISRPCQSWA SQ GSRQGSKECPGCAKLVPGPSPRAFGLEQPPLPEASGRHKKLERMYSVDGVSDDVPIRTWFPKENPFSFQTATTTMQAISV SQ FRGYAERKRRKRENDSASVIQRNFRKHLRMVGSRRVKAQTFAERRERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTL SQ DEACEDLDWDTEKGLEATACDTEGFLPPKVMLISSKVPKAEYIPTIIRRDDPSIIPILYDHEHATFEDILEEIEKKLNIY SQ HKGAKIWKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVIHIMGCYILGNPNGEKLFQNL SQ RTLMTPYKVTFESPLELSAQGKQMIETYFDFRLYRLWKSRQHSKLLDFDDVL //