ID Q9EST1; PN Gasdermin-A, C-terminal; GN Gsdma; OS 10090; SL Nucleus Position: SL-0198; SL Comments: [Gasdermin-A]: Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:Q96QA5}. Cytoplasm, cytosol {ECO:0000250|UniProtKB:Q5Y4Y6}. [Gasdermin-A, N-terminal]: Cell membrane {ECO:0000250|UniProtKB:Q5Y4Y6}; Multi-pass membrane protein {ECO:0000250|UniProtKB:Q5Y4Y6}. DR UNIPROT: Q9EST1; DR UNIPROT: A3KFN3; DR Pfam: PF04598; DR Pfam: PF17708; DE Function: [Gasdermin-A]: This form constitutes the precursor of the pore-forming protein: upon cleavage, the released N-terminal moiety (Gasdermin-A, N-terminal) binds to membranes and forms pores, triggering cell death. {ECO:0000250|UniProtKB:Q96QA5}. [Gasdermin-A, N-terminal]: Pore-forming protein that causes membrane permeabilization and pyroptosis. Released upon cleavage of Gasdermin-A, and binds to membrane inner leaflet lipids. Homooligomerizes within the membrane and forms pores of 10-15 nanometers (nm) of inner diameter, triggering pyroptosis. Binds to membrane inner leaflet lipids, such as phosphatidylinositol (4,5)- bisphosphate. The functional mechanisms and physiological proteases that cleave and activate this pore-forming protein are unknown. {ECO:0000250|UniProtKB:Q96QA5}. DE Reference Proteome: Yes; DE Interaction: Q6AXH7; IntAct: EBI-6876709; Score: 0.35 GO GO:0005737; GO GO:0005829; GO GO:0016021; GO GO:0048471; GO GO:0005886; GO GO:0005546; GO GO:0070273; GO GO:0001786; GO GO:0006915; GO GO:0042742; GO GO:0070269; TP Membrane Topology: Transmembrane; Source: UniProt - By Similarity {ECO:0000250|UniProtKB:Q5Y4Y6}; SQ MTMFENVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVHTDYTLLDVLEPGSSPSDPTDSGNFS SQ FKNMLDARVEGDVDVPKTVKVKGTAGLSRSSTLEVQTLSVAPTALENLHKERKLSADHPFLKEMRERGENLYVVMEVVET SQ LQEVTLERAGKAEGCFSLPFFAPLGLQGSVNHKEAVTIPKGCVLAYRVRQLMVNGKDEWGIPHICNDSMQTFPPGEKPGE SQ GKFILIQASDVGEMHEDFKTLKEEVQRETQEVEKLSPVGRSSLLTSLSHLLGKKKELQDLEQTLEGALDKGHEVTLEALP SQ KDVLLSKDAMDAILYFLGALTVLSEAQQKLLVKSLEKKILPVQLKLVESTMEKNFLQDKEGVFPLQPDLLSSLGEEELIL SQ TEALVGLSGLEVQRSGPQYTWDPDTLPHLCALYAGLSLLQLLSKNS //