ID Q9FF75; PN SUN domain-containing protein 1; GN SUN1; OS 3702; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0179; SL Nucleus Position: SL-0182; SL Comments: Nucleus inner membrane {ECO:0000269|PubMed:19807882, ECO:0000269|PubMed:21294795, ECO:0000269|PubMed:24667841, ECO:0000269|PubMed:25412930}; Single-pass type II membrane protein {ECO:0000255}. Cytoplasm, cytoskeleton, phragmoplast {ECO:0000269|PubMed:21294795}. Endoplasmic reticulum membrane {ECO:0000269|PubMed:21294795}; Single-pass type II membrane protein {ECO:0000255}. Nucleus envelope {ECO:0000269|PubMed:22270916}. Note=Dynamic localization during mitosis and meosis, tightly coupled with nuclear envelope (NE) dynamics. Localized with the nuclear envelope during meiotic prophase I. NE re-formation during metaphase is temporally and spatially coordinated with plant-specific microtubule structures such as phragmoplasts. During anaphase, after NE breakdown (NEBD), predominantly localized with the endoplasmic reticulum, in the outside of the segregated chromosomes and not in between segregated chromosomes. {ECO:0000269|PubMed:21294795, ECO:0000269|PubMed:25412930}. DR UNIPROT: Q9FF75; DR Pfam: PF07738; DR PROSITE: PS51469; DE Function: Component of SUN-protein-containing multivariate complexes also called LINC complexes which link the nucleoskeleton and cytoskeleton by providing versatile outer nuclear membrane attachment sites for cytoskeletal filaments (PubMed:24667841, PubMed:25759303). Required for the maintenance and/or formation of polarized nuclear shape in root hairs (PubMed:21294795, PubMed:25759303). Modulates the anchoring and mobility of WIP proteins and RANGAP1 in the nuclear envelope (NE) (PubMed:22270916). In association with SUN2, may be involved in telomere attachment to nuclear envelope in the prophase of meiosis (PubMed:25412930). As component of the SUN-WIP-WIT2-KAKU1 complex, mediates the transfer of cytoplasmic forces to the nuclear envelope (NE), leading to nuclear shape changes (PubMed:25759303). {ECO:0000269|PubMed:21294795, ECO:0000269|PubMed:22270916, ECO:0000269|PubMed:24667841, ECO:0000269|PubMed:25412930, ECO:0000269|PubMed:25759303}. DE Reference Proteome: Yes; DE Interaction: Q8RWU6; IntAct: EBI-4502264; Score: 0.37 DE Interaction: Q9FG89; IntAct: EBI-4514232; Score: 0.37 DE Interaction: Q9SG79; IntAct: EBI-11657653; Score: 0.37 DE Interaction: Q9FH18; IntAct: EBI-11657658; Score: 0.37 GO GO:0005856; GO GO:0005783; GO GO:0005789; GO GO:0005639; GO GO:0005635; GO GO:0009524; GO GO:0043621; GO GO:0043495; GO GO:0070197; GO GO:0006998; GO GO:0006997; GO GO:0051291; GO GO:0051260; GO GO:0090435; GO GO:2000769; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MSASTVSITANTAAATRRTPILAGEKKSNFDYPQSESLANGGVGEAGGTSRDLSRGEATLDRSQGQDLGPVTRRSVSAAT SQ GTNTTATQRRTRKVATPKSEKARWKTVVRIFAKQLGALLIIVGLIQLTRKMILKASSPSSPISSYETEMAFSGLESRIAE SQ VDGLVKATTNSMQVQVELLDKKMEREAKVLRQEIERKASAFQSELKKIESRTESLEKSVDEVNAKPWVTKDELERIYEEL SQ KKGNVDDSAFSEISIDELRAYARDIMEKEIEKHAADGLGRVDYALASGGAFVMEHSDPYLVGKGSSWFATTMRRAHTNAV SQ KMLSPSFGEPGQCFPLKGSEGYVQIRLRGPIIPEAFTLEHVAKSVAYDRSSAPKDCRVSGSLQGPESSAETENMQLLTEF SQ TYDLDRSNAQTFNILESSSSGLIDTVRLDFTSNHGSDSHTCIYRFRVHGRAPDPVPVVGTNLDQDSSPESE //