ID Q9FMH6; PN WPP domain-containing protein 1; GN WPP1; OS 3702; SL Nucleus Position: SL-0178; SL Comments: Nucleus envelope {ECO:0000269|PubMed:15548735}. Cytoplasm {ECO:0000269|PubMed:15548735}. Nucleus {ECO:0000269|PubMed:15548735}. Golgi apparatus {ECO:0000250}. Nucleus matrix {ECO:0000250}. Note=Associated to the nuclear envelope (NE) in undifferentiated cells of the root tip. Associated with the outer NE and the nuclear pores in interphase cells and with the immature cell plate during cytokinesis. In differentiated cells, localized in both cytoplasm and nucleus. Accumulate in speckles of the cytoplasm belonging to the Golgi apparatus (By similarity). Appears at the NE as cells reenter the cell cycle during dedifferentiation. {ECO:0000250}. DR UNIPROT: Q9FMH6; DR UNIPROT: Q8L8R9; DR Pfam: PF13943; DE Function: Regulates the mitotic activity in roots. Plays a role with HSP70-1 in facilitating WIT1 nuclear envelope targeting. {ECO:0000269|PubMed:15548735, ECO:0000269|PubMed:19617588}. DE Reference Proteome: Yes; DE Interaction: Q8GXA4; IntAct: EBI-1779601; Score: 0.37 DE Interaction: Q94AV5; IntAct: EBI-1779613; Score: 0.37 DE Interaction: Q9FH18; IntAct: EBI-1779608; Score: 0.37 GO GO:0005794; GO GO:0016363; GO GO:0005640; GO GO:0009536; GO GO:0048527; GO GO:0000278; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MAETETESITTSSPPPISETENSTTLPTTETEKNPNPVTISLRIWPPTQKTRDAVINRLIETLSTESILSKRFGSLESEE SQ ASSVAKSIEDEAYAIASATVFGDDDGIEILKAYSKEISKRMLESVKAKSNVASPPPKDGDGIESAVDSKIDSSEA //