ID Q9FZK4; PN Nuclear transport factor 2A, N-terminally processed; GN NTF2A; OS 3702; SL Nucleus Position: SL-0178; SL Comments: Cytoplasm {ECO:0000269|PubMed:15610358, ECO:0000269|PubMed:16428596}. Nucleus {ECO:0000269|PubMed:15610358, ECO:0000269|PubMed:16428596}. Nucleus envelope {ECO:0000269|PubMed:16428596}. Note=Accumulates at the nuclear rim. Excluded from the nucleolus. {ECO:0000269|PubMed:16428596}. DR UNIPROT: Q9FZK4; DR Pfam: PF02136; DR PROSITE: PS50177; DE Function: Facilitates protein transport into the nucleus. Interacts with various nucleoporins and with Ran-GDP. Could be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import. {ECO:0000269|PubMed:16428596}. DE Reference Proteome: Yes; GO GO:0005737; GO GO:0005829; GO GO:0005635; GO GO:0044613; GO GO:0005634; GO GO:0031267; GO GO:0006913; GO GO:0006606; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MDPDAVAKAFVEHYYSTFDANRPGLVSLYQEGSMLTFEGQKIQGSQNIVAKLTGLPFQQCKHNITTVDCQPSGPAGGMLV SQ FVSGNLQLAGEQHALKFSQMFHLISNQGNYYVFNDIFRLNYA //