ID Q9GYU8; PN Nuclear pore complex protein Nup88; GN mbo; OS 7227; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Nucleus Position: SL-0185; SL Comments: Nucleus, nuclear pore complex {ECO:0000269|PubMed:10921908}. Nucleus membrane {ECO:0000269|PubMed:10921908, ECO:0000269|PubMed:17032737}; Peripheral membrane protein {ECO:0000269|PubMed:10921908}; Cytoplasmic side {ECO:0000269|PubMed:10921908}. Chromosome {ECO:0000269|PubMed:20144761}. Nucleus, nucleoplasm {ECO:0000269|PubMed:20144761}. Note=Is recruited to non-active chromatin sites (PubMed:20144761). Localization to the nuclear rim is promoted by Nup214 (PubMed:17032737). {ECO:0000269|PubMed:17032737, ECO:0000269|PubMed:20144761}. DR UNIPROT: Q9GYU8; DR UNIPROT: Q9VG41; DR Pfam: PF10168; DE Function: Essential component of nuclear pore complex (PubMed:10921908, PubMed:14638854, PubMed:17032737). Required for the anchoring of Nup214 and emb on the nuclear envelope and thereby attenuates nuclear export signal (NES)-mediated nuclear export (PubMed:14638854). Together with Nup214, required for the nuclear import of the Rel family transcription factors dorsal (dl) and Dorsal-related immunity factor (Dif) and the activation of an immune response (PubMed:10921908, PubMed:17032737). {ECO:0000269|PubMed:10921908, ECO:0000269|PubMed:14638854, ECO:0000269|PubMed:17032737}. DE Reference Proteome: Yes; DE Interaction: Q7JXF5; IntAct: EBI-280213; Score: 0.00 DE Interaction: A1Z6E8; IntAct: EBI-202832; Score: 0.00 DE Interaction: Q7K0A0; IntAct: EBI-225767; Score: 0.00 DE Interaction: Q9VUG5; IntAct: EBI-230580; Score: 0.00 DE Interaction: Q9VZ87; IntAct: EBI-232035; Score: 0.00 DE Interaction: Q9VK23; IntAct: EBI-243781; Score: 0.00 DE Interaction: Q9W4L6; IntAct: EBI-244337; Score: 0.00 DE Interaction: Q9VWQ6; IntAct: EBI-253899; Score: 0.00 DE Interaction: Q9VND7; IntAct: EBI-259900; Score: 0.00 DE Interaction: Q9VNE1; IntAct: EBI-260005; Score: 0.00 DE Interaction: Q86B91; IntAct: EBI-263437; Score: 0.00 DE Interaction: Q9VF13; IntAct: EBI-263482; Score: 0.00 DE Interaction: Q9VVK7; IntAct: EBI-265915; Score: 0.00 DE Interaction: Q9VSB2; IntAct: EBI-266411; Score: 0.00 DE Interaction: Q9VFF6; IntAct: EBI-269996; Score: 0.00 DE Interaction: Q9XYW6; IntAct: EBI-277061; Score: 0.00 DE Interaction: Q8INY6; IntAct: EBI-278797; Score: 0.00 DE Interaction: Q9Y091; IntAct: EBI-280296; Score: 0.00 DE Interaction: A1ZAW3; IntAct: EBI-280793; Score: 0.00 DE Interaction: Q9VC66; IntAct: EBI-281109; Score: 0.00 DE Interaction: Q9VT69; IntAct: EBI-281332; Score: 0.00 DE Interaction: Q9VVT5; IntAct: EBI-281639; Score: 0.00 DE Interaction: Q9VTP5; IntAct: EBI-281643; Score: 0.00 DE Interaction: Q9VS62; IntAct: EBI-281647; Score: 0.00 DE Interaction: Q9VS38; IntAct: EBI-281651; Score: 0.00 DE Interaction: Q9VVB4; IntAct: EBI-281655; Score: 0.00 DE Interaction: Q9W1A4; IntAct: EBI-464017; Score: 0.40 DE Interaction: P98149; IntAct: EBI-872370; Score: 0.27 DE Interaction: P15330; IntAct: EBI-872434; Score: 0.27 DE Interaction: P92177; IntAct: EBI-8283416; Score: 0.35 GO GO:0000785; GO GO:0005635; GO GO:0031981; GO GO:0031965; GO GO:0005643; GO GO:0005654; GO GO:0003682; GO GO:0017056; GO GO:0019730; GO GO:0006406; GO GO:0046826; GO GO:0006606; GO GO:0000055; GO GO:0000056; TP Membrane Topology: Peripheral; Source: UniProt - Experimental Evidence {ECO:0000269|PubMed:10921908}; SQ MSLTDVLELNKTELFAKIRNGLPVVQRTQNLLDCKDDLLFAWHAKDSCLLVRNWRSSLAAKVNIQFQTLIPSSLVSLEVD SQ RVLASNEGSLVALSGPRGVVIMELPRRWGPDGYYKDGKPVITCRTFGLDTQLFLKNPHLEVRQVRWHPHSVSDSTLLVLL SQ NNNTIRVYNHSKLRHVWQVGPPVLRSGANNSLCDFGELAVDFDIAPAAKPRVTEPETAGNNETTLDKSNKTLVAAKSLPK SQ QERIEWPMVVLRENGNIYILMTGVDSENTRLQGPVTITPQAHDNYGLESCALMIIPSLPPTIVIAESNGKLHHALLMEAE SQ ATEHSFNEVDDSVLIEPAEYVVHVLETVELELGISAPATGKEGGNCPIYLKRDLINELRYFAYHNAGLHAVTVSFIAELQ SQ RYLESESDEDRLELAVSASAEYILCTKFDSSETVNAVFGLALLQIPAGIVLLLGSGQVISLKLVIDAQLLVTPNENKPVD SQ SEVSQQESGPPFVDTIKSLLQRSVNQPILADKLSSPSAQESFELLNQAIEVLREQYLKRHDLVRAAFTRHINQIQLKKEQ SQ QLQEIQDLEQERELISERAHKLAERFEEISYNQELLVRKCNALMQRANASLPNSVIAEREFSQEVIRLNKVTQSLAAGLE SQ TAKKTFNKQRYHIAQSQEDLKKNAYELPEKQHRTITEILTQLTGEIDRQITDVKRINKIVGI //