ID Q9GZV4; PN Eukaryotic translation initiation factor 5A-2; GN EIF5A2; OS 9606; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0185; SL Comments: Cytoplasm {ECO:0000250}. Nucleus {ECO:0000250}. Endoplasmic reticulum membrane {ECO:0000250}; Peripheral membrane protein {ECO:0000250}; Cytoplasmic side {ECO:0000250}. Nucleus, nuclear pore complex {ECO:0000250}. Note=Hypusine modification promotes the nuclear export and cytoplasmic localization and there was a dynamic shift in the localization from predominantly cytoplasmic to primarily nuclear under apoptotic inducing conditions. {ECO:0000250}. DR UNIPROT: Q9GZV4; DR UNIPROT: B2R4V5; DR Pfam: PF01287; DR PROSITE: PS00302; DR OMIM: 605782; DR DisGeNET: 56648; DE Function: mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Critical for the efficient synthesis of peptide bonds between consecutive proline residues. Can resolve ribosomal stalling caused by consecutive prolines during translation (By similarity). Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Functions as a regulator of apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation (By similarity). {ECO:0000250, ECO:0000250|UniProtKB:P63241, ECO:0000269|PubMed:14622290}. DE Reference Proteome: Yes; DE Interaction: Q96CV9; IntAct: EBI-6115969; Score: 0.35 DE Interaction: P49366; IntAct: EBI-756238; Score: 0.78 DE Interaction: P43146; IntAct: EBI-2678596; Score: 0.35 DE Interaction: Q9H492; IntAct: EBI-3044058; Score: 0.35 DE Interaction: Q9H0R8; IntAct: EBI-3048562; Score: 0.35 DE Interaction: Q15771; IntAct: EBI-3924283; Score: 0.37 DE Interaction: Q9UKA9; IntAct: EBI-3924886; Score: 0.37 DE Interaction: P03496; IntAct: EBI-6158649; Score: 0.35 DE Interaction: Q13620; IntAct: EBI-21327757; Score: 0.35 DE Interaction: Q13618; IntAct: EBI-21329068; Score: 0.35 DE Interaction: O00560; IntAct: EBI-10304015; Score: 0.72 DE Interaction: Q04864; IntAct: EBI-10304037; Score: 0.56 DE Interaction: Q9GZT8; IntAct: EBI-10304047; Score: 0.56 DE Interaction: Q9UJX2; IntAct: EBI-10304057; Score: 0.56 DE Interaction: Q9BU89; IntAct: EBI-21850571; Score: 0.35 DE Interaction: P51957; IntAct: EBI-20721387; Score: 0.35 DE Interaction: Q9UQC2; IntAct: EBI-25384304; Score: 0.35 DE Interaction: P69479; IntAct: EBI-25568051; Score: 0.35 GO GO:0005829; GO GO:0005789; GO GO:0043231; GO GO:0005643; GO GO:0043022; GO GO:0003723; GO GO:0003746; GO GO:0051028; GO GO:0010509; GO GO:0045901; GO GO:0045905; GO GO:0015031; GO GO:0007283; TP Membrane Topology: Peripheral; Source: UniProt - By Similarity {ECO:0000250}; SQ MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMD SQ VPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK //