ID Q9JIB0; PN Ran guanine nucleotide release factor; GN Rangrf; OS 10090; SL Nucleus Position: SL-0198; SL Comments: Nucleus {ECO:0000269|PubMed:10811801, ECO:0000269|PubMed:11733047}. Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:Q9HD47}. Cytoplasm {ECO:0000269|PubMed:18184654}. Cell membrane {ECO:0000250|UniProtKB:Q9HD47}; Peripheral membrane protein {ECO:0000250|UniProtKB:Q9HD47}; Cytoplasmic side {ECO:0000250|UniProtKB:Q9HD47}. Note=Shuttles between the nucleus and cytoplasm. {ECO:0000269|PubMed:11733047}. DR UNIPROT: Q9JIB0; DR UNIPROT: Q9CWZ0; DR Pfam: PF04603; DE Function: May regulate the intracellular trafficking of RAN (PubMed:10811801, PubMed:11733047). Promotes guanine nucleotide release from RAN and inhibits binding of new GTP by preventing the binding of the RAN guanine nucleotide exchange factor RCC1 (PubMed:10811801, PubMed:11733047). Regulates the levels of GTP-bound RAN in the nucleus, and thereby plays a role in the regulation of RAN-dependent mitotic spindle dynamics (By similarity). Enhances the expression of SCN5A at the cell membrane in cardiomyocytes (PubMed:18184654, PubMed:23420830). {ECO:0000250|UniProtKB:Q9HD47, ECO:0000269|PubMed:10811801, ECO:0000269|PubMed:11733047, ECO:0000269|PubMed:18184654, ECO:0000269|PubMed:23420830}. DE Reference Proteome: Yes; DE Interaction: Q61820; IntAct: EBI-310252; Score: 0.37 DE Interaction: Q9Z0S9; IntAct: EBI-20974786; Score: 0.37 GO GO:0005901; GO GO:0005737; GO GO:0005829; GO GO:0014704; GO GO:0005654; GO GO:0005634; GO GO:0048471; GO GO:0005791; GO GO:0005085; GO GO:0031267; GO GO:0017080; GO GO:0044325; GO GO:0006888; GO GO:0060047; GO GO:0006913; GO GO:2000010; GO GO:1903078; GO GO:0032527; GO GO:0006606; GO GO:0098905; GO GO:0098909; GO GO:0003254; GO GO:1900825; GO GO:0042391; GO GO:0090226; GO GO:1902305; GO GO:2000649; TP Membrane Topology: Peripheral; Source: UniProt - By Similarity {ECO:0000250|UniProtKB:Q9HD47}; SQ MEPNRNCPLFGGAFSAILPTGAIDVSDLRPVPDNQEVFCHPVTDQSLIIELLELQAHVQGEAAARYHFEDVGRVQGARAV SQ HVLSVQPLCLENLSLRGCCQDAWSLSGKQQVAKENQQVAKDVTLHQALLRLPQYQTDLLLTFNQPPCHSRSLGPENLSCP SQ PWSLSNFEQLVTSLTLHDPNLFGPQ //