ID Q9JLK4; PN Calcium-binding protein 2; GN Cabp2; OS 10090; SL Nucleus Position: SL-0198; SL Comments: Cytoplasm, perinuclear region {ECO:0000250}. Cell membrane {ECO:0000250}; Lipid-anchor {ECO:0000250}; Cytoplasmic side {ECO:0000250}. Golgi apparatus {ECO:0000250}. DR UNIPROT: Q9JLK4; DR UNIPROT: Q3KNX9; DR UNIPROT: Q9JLK5; DR Pfam: PF00036; DR Pfam: PF13499; DR PROSITE: PS00018; DR PROSITE: PS50222; DE Function: Required for sound encoding at inner hair cells (IHCs) synapses, likely via inhibition of the inactivation of voltage-gated calcium channel of type 1.3 (Cav1.3) in the IHCs (PubMed:28183797). Required for the normal transfer of light signals through the retina (PubMed:27822497). {ECO:0000269|PubMed:27822497, ECO:0000269|PubMed:28183797}. DE Reference Proteome: Yes; GO GO:0005737; GO GO:0005794; GO GO:0048471; GO GO:0005886; GO GO:0005246; GO GO:0005509; GO GO:1901385; GO GO:0050896; GO GO:0007605; GO GO:0007601; TP Membrane Topology: Lipid-Anchored; Source: UniProt - By Similarity {ECO:0000250}; SQ MGNCAKTPWHRGSKERWQWPGSPLGGSRPSPGPRTEEQEGTQGYSVLGSLVGPACIFLRPSIAATQLDRELRPEEIEELQ SQ IAFQEFDRDRDGYIGYRELGACMRTLGYMPTEMELIEISQQISGGKVDFEDFVELMGPKLLAETADMIGVRELRDAFREF SQ DTNGDGCISVGELRAALKALLGERLSQREVDEILQDIDLNGDGLVDFEEFVRMMSR //