ID Q9LH52; PN Leucine-rich repeat protein FLOR 1; GN FLR1; OS 3702; SL Nucleus Position: SL-0198; SL Comments: Cytoplasm {ECO:0000269|Ref.7}. Nucleus {ECO:0000269|Ref.7}. Cytoplasm, perinuclear region {ECO:0000269|Ref.7}. Cell membrane {ECO:0000269|Ref.7}. Note=In carpels, observed both in cytoplasm and nucleus, as well as in the perinuclear and cell membrane in a vesicle-like pattern. In style cells, present in cytoplasm as well as in nucleus possibly in the perinuclear membrane. In leaf tissue, observed in the plasma membrane and in the perinuclear membrane. In roots and tapetum cells, restricted to the cytoplasm. {ECO:0000269|Ref.7}. DR UNIPROT: Q9LH52; DR UNIPROT: Q93ZC1; DR UNIPROT: Q9C7D9; DR UNIPROT: Q9M7E7; DR Pfam: PF00560; DR Pfam: PF08263; DE Function: Promotes flowering transition in long days (LD). {ECO:0000269|PubMed:22319055}. DE Reference Proteome: Yes; GO GO:0005737; GO GO:0005634; GO GO:0048471; GO GO:0005886; GO GO:0048574; GO GO:0048510; GO GO:0010228; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MKLFVHLSIFFSILFITLPSSYSCTENDKNALLQIKKALGNPPLLSSWNPRTDCCTGWTGVECTNRRVTGLSVTSGEVSG SQ QISYQIGDLVDLRTLDFSYLPHLTGNIPRTITKLKNLNTLYLKHTSLSGPIPDYISELKSLTFLDLSFNQFTGPIPGSLS SQ QMPKLEAIQINDNKLTGSIPNSFGSFVGNVPNLYLSNNKLSGKIPESLSKYDFNAVDLSGNGFEGDAFMFFGRNKTTVRV SQ DLSRNMFNFDLVKVKFARSIVSLDLSQNHIYGKIPPALTKLHLEHFNVSDNHLCGKIPSGGLLQTFEPSAFAHNICLCGT SQ PLKAC //