ID  Q9LU93;
PN  Mitotic spindle checkpoint protein MAD2;
GN  MAD2;
OS  3702;
SL  Nucleus Position: SL-0178;
SL  Comments: Nucleus {ECO:0000269|PubMed:19710914, ECO:0000269|PubMed:22457071}. Nucleus envelope {ECO:0000269|PubMed:22457071}. Chromosome {ECO:0000269|PubMed:19710914}. Chromosome, centromere, kinetochore {ECO:0000269|PubMed:19710914}. Cytoplasm, cytoskeleton, spindle {ECO:0000269|PubMed:19710914}. Cytoplasm {ECO:0000269|PubMed:19710914, ECO:0000269|PubMed:22457071}. Note=Cytoplasmic in interphase cells. Accumulates onto both kinetochores and the spindle microtubules in cell arrested in metaphase. Present in chromocenters. Associates with unattached kinetochores upon spindle assembly checkpoint (SAC) activation. The nucleus envelope association requires the presence of NUA. {ECO:0000269|PubMed:22457071}.
DR  UNIPROT: Q9LU93;
DR  UNIPROT: Q67YV5;
DR  Pfam: PF02301;
DR  PROSITE: PS50815;
DE  Function: Required for the execution of the mitotic checkpoint which monitors the process of kinetochore-spindle attachment and delays the onset of anaphase when this process is not complete. It inhibits the activity of the anaphase promoting complex by sequestering CDC20 until all chromosomes are aligned at the metaphase plate. {ECO:0000269|PubMed:19710914}.
DE  Reference Proteome: Yes;
DE  Interaction: P92960; IntAct: EBI-2131492; Score: 0.00
DE  Interaction: O82782; IntAct: EBI-2131492; Score: 0.00
DE  Interaction: Q940Y8; IntAct: EBI-2131492; Score: 0.00
DE  Interaction: Q9FIQ0; IntAct: EBI-2131492; Score: 0.00
DE  Interaction: Q9SIH1; IntAct: EBI-2131492; Score: 0.00
DE  Interaction: Q9ZVX3; IntAct: EBI-2131492; Score: 0.00
DE  Interaction: Q9FLL1; IntAct: EBI-2131492; Score: 0.00
DE  Interaction: Q8GXK3; IntAct: EBI-2131492; Score: 0.00
DE  Interaction: Q9M0I4; IntAct: EBI-2131492; Score: 0.00
DE  Interaction: Q9ZVJ4; IntAct: EBI-2131492; Score: 0.00
DE  Interaction: Q9SZP8; IntAct: EBI-2131492; Score: 0.00
DE  Interaction: Q9LW88; IntAct: EBI-2131492; Score: 0.00
DE  Interaction: Q9SN19; IntAct: EBI-2131492; Score: 0.00
DE  Interaction: Q6NLH0; IntAct: EBI-2131492; Score: 0.00
DE  Interaction: Q8LPJ4; IntAct: EBI-2651676; Score: 0.00
DE  Interaction: O48802; IntAct: EBI-2651676; Score: 0.00
DE  Interaction: Q9M0Z6; IntAct: EBI-2651676; Score: 0.00
DE  Interaction: Q8GYU3; IntAct: EBI-2651676; Score: 0.00
DE  Interaction: Q9FT72; IntAct: EBI-2651676; Score: 0.00
DE  Interaction: Q9SF16; IntAct: EBI-2651676; Score: 0.00
DE  Interaction: O64768; IntAct: EBI-2651676; Score: 0.00
DE  Interaction: Q9C5C8; IntAct: EBI-2651676; Score: 0.00
DE  Interaction: Q9SB63; IntAct: EBI-2651676; Score: 0.00
DE  Interaction: Q93VP3; IntAct: EBI-2651676; Score: 0.00
DE  Interaction: Q93ZX4; IntAct: EBI-2651676; Score: 0.00
DE  Interaction: Q9C774; IntAct: EBI-2651676; Score: 0.00
GO  GO:0010369;
GO  GO:0005737;
GO  GO:0000776;
GO  GO:0005828;
GO  GO:0005635;
GO  GO:0005654;
GO  GO:0005634;
GO  GO:0005876;
GO  GO:0051301;
GO  GO:0007094;
GO  GO:0007346;
TP  Membrane Topology: Unknown; Source: UniProt - Sequence Analysis;
SQ  MASKTAAAKDIITLHGSAAIVSEFFCYAANSILYNRAVYPEESFVKVKKYGLPMLLIEDESVKSFMSNLTSQISEWLEAG
SQ  KLQRVVLVIMSKATGEVLERWNFRIETDNEVVDKGVSREKSDKEIMREIQAIMRQVASSVTYLPCLDETCVFDVLAYTDT
SQ  DVAVPFTWIESDPKLIANPQMVKLHGFDTKIHKVDTLVSYKNDEWDEEE
//