ID Q9M651; PN RAN GTPase-activating protein 2; GN RANGAP2; OS 3702; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Comments: Cytoplasm. Nucleus membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton, spindle. Cytoplasm, cytoskeleton, phragmoplast. Note=Localized in patchy areas at the nuclear envelope of interphase cells. During mitosis, associates with mitotic spindles at the anaphase. Associated to the microtubular phragmoplast and the surface of the daughter nuclei at the telophase. DR UNIPROT: Q9M651; DR Pfam: PF13516; DR Pfam: PF13943; DE Function: GTPase activator for the nuclear Ras-related regulatory protein Ran, converting it to the putatively inactive GDP-bound state. {ECO:0000269|PubMed:12061901}. DE Reference Proteome: Yes; DE Interaction: Q8GXA4; IntAct: EBI-1779572; Score: 0.37 DE Interaction: Q8L7E5; IntAct: EBI-1796671; Score: 0.37 DE Interaction: Q9FH18; IntAct: EBI-1779579; Score: 0.37 GO GO:0005783; GO GO:0005635; GO GO:0031965; GO GO:0009524; GO GO:0000325; GO GO:0009536; GO GO:0005819; GO GO:0005096; GO GO:0006913; TP Membrane Topology: Peripheral; Source: UniProt - Sequence Analysis; SQ MADILDSRPHAFSIKLWPPSLPTRKALIERITNNFSSKTIFTEKYGSLTKDQATENAKRIEDIAFSTANQQFEREPDGDG SQ GSAVQLYAKECSKLILEVLKKGPVAKVAARELISEDSVSPRETFFDISKGKRAFIEAEEAEELLKPLKEPGNAYTKICFS SQ NRSFGLGAARVAEPILASLKDQLKEVDLSDFVAGRPELEALEVMNIFSDALQGSILSSLNLSDNALGEKGVRAFGALLKS SQ LSSLEELYLMNDGISKEAAQAVSELIPSTENLRVLHFHNNMTGDEGALAIAEVVKRSPLLENFRCSSTRVGSKGGIALSE SQ ALEHCTHMEKLDLRDNMFGTEAGVSLSKTLSSFKHMTELYLSYLNLEDEGAIAIVNALKESASPIEVLEMAGNDITVEAA SQ SAIAACVAAKQDLNKLNLSENELKDEGCVQIANCIEEGHSKLQYIDMSTNYIRRAGARALAHVVVKKEAFKLLNIDGNII SQ SEEGIEELKEIFKKSPELLGALDENDPDGEEDDDDEEDEEDEENEGNGNGELESKLKNLEVNQED //