ID Q9N261; PN Leupaxin; GN LPXN; OS 9986; SL Nucleus Position: SL-0198; SL Comments: Cytoplasm {ECO:0000250}. Cell junction, focal adhesion {ECO:0000250}. Nucleus {ECO:0000250}. Cytoplasm, perinuclear region {ECO:0000250}. Cell projection, podosome {ECO:0000250}. Cell membrane {ECO:0000250}. Note=Shuttles between the cytoplasm and nucleus. Recruited to the cell membrane following B-cell antigen receptor (BCR) cross-linking in B-cells. Enhanced focal adhesion kinase activity (PTK2/FAK) attenuates its nuclear accumulation and limits its ability to enhance serum response factor (SRF)-dependent gene transcription. Targeting to focal adhesions is essential for its tyrosine phosphorylation in response to bombesin (By similarity). {ECO:0000250}. DR UNIPROT: Q9N261; DR UNIPROT: G1TMN6; DR Pfam: PF00412; DR PROSITE: PS00478; DR PROSITE: PS50023; DE Function: Transcriptional coactivator for androgen receptor (AR) and serum response factor (SRF). Contributes to the regulation of cell adhesion, spreading and cell migration and acts as a negative regulator in integrin-mediated cell adhesion events. Suppresses the integrin- induced tyrosine phosphorylation of paxillin (PXN). May play a critical role as an adapter protein in the formation of the adhesion zone in osteoclasts. Negatively regulates B-cell antigen receptor (BCR) signaling (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; GO GO:0042995; GO GO:0005925; GO GO:0005634; GO GO:0048471; GO GO:0005886; GO GO:0002102; GO GO:0046872; GO GO:0007155; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MEELDALLEELERSTLQDSDEYSNSAPLPLDQSSRKESNLDETSKMLSVQDSTNPFPVQLVYTTNIQDRNVYSEVQEPKK SQ SPPPAKTSAAAQLDELMAHLSEMQAKVSVKADAGKKPVSENLDHKASLDSMLGGLEQELQNLGIPTVPKGHCASCQKPIV SQ GKVIHALGQSWHPEHFICTHCKEEIGSSPFFERSGLAYCPKDYHHLFSPRCAYCAAPILDKVLTAMNQTWHPEHFFCSHC SQ GEVFGTEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMNTVWHPECFVCGDCFSSFSTGSFFELEGRPFCELH SQ YHQRRGTLCHGCGQPITGRCISAMGHKFHPEHFVCAFCLTQLSKGVFREQNDKTYCQPCFNKLFSL //