ID Q9N303; PN P-granule-associated protein deps-1; GN deps; OS 6239; SL Nucleus Position: SL-0198; SL Comments: Cytoplasmic granule {ECO:0000269|PubMed:18234720, ECO:0000269|PubMed:32843637}. Cytoplasm, perinuclear region {ECO:0000269|PubMed:32843637}. Note=Localizes to P-granules in germ cells at all stages of development (PubMed:18234720). Co-localizes with prg-1 at peri-nuclear P-granules in the proliferative zone and transition zone, at pachytene, in oocytes and in embryos (PubMed:32843637). In the distal loop, a higher proportion of deps-1 than prg-1 dissociates from the perinuclear region (PubMed:32843637). In the adult germline, co-localizes with znfx-1 at P-granules and with pgl-1 at P-granules in the pachytene region (PubMed:32843637). {ECO:0000269|PubMed:18234720, ECO:0000269|PubMed:32843637}. DR UNIPROT: Q9N303; DR UNIPROT: V6CLC9; DE Function: Component of P-granules which is required for P-granule formation and integrity in adult germ cells (PubMed:18234720). Promotes the accumulation of glh-1 mRNA and localization of pgl-1 to P-granules (PubMed:18234720). Involved in RNA-mediated gene silencing (RNAi) in the germline (PubMed:18234720, PubMed:32843637). In particular, it is required for piwi-interacting RNA (piRNA) gene silencing and positively regulates the formation of secondary 22G-RNAs, which are RNA-dependent RNA polymerase-derived endo-siRNAs, typically 22 nucleotides in length with a 5'guanosine residue (PubMed:32843637). Its role in RNAi may also be through positively regulating the expression of the dsRNA-binding protein rde-4 (PubMed:18234720). Plays a role in small RNA-directed transgenerational epigenetic inheritance (PubMed:27015309, PubMed:29769721). {ECO:0000269|PubMed:18234720, ECO:0000269|PubMed:27015309, ECO:0000269|PubMed:29769721, ECO:0000269|PubMed:32843637}. DE Reference Proteome: Yes; GO GO:0043186; GO GO:0048471; GO GO:0031047; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MSERQSKYFDYQGIVISSTGQDNQDSETDLVYLIQAHGKAAPKNIMYGVSKCAFVPTNLERNFDNIEEAKNLERRSKIPL SQ KFGEVILWNESDCDHDKRIILHIKREKPIYEASSSRNGLILKVGGVIQPTSTTSFWTPLCTVTMPETEATRAEPDVWLYA SQ WIRFETTMKSGLDPFNMTATFESFDSCDPSDQARVCEAPWNAGSPDSKFGVWRPDPKPADSDDEIDIEPREGWHLPEDKW SQ AEVIKMQLGLYVGERLLICKELSQFDFIIPLQKPFSRGTDKTLIYPAVGEYFHFSAIWSMQHNGFLIYELQPVPLLRQHV SQ TSVNGNLLTRVVPASIRGLFVDKEGTLGLIDDPHHLLSFFEFHPAGYEFLKAMAEVRAVRTSENKSVRYRIVRTSGMSIF SQ ENWLRDTQFVVGPVKGIRINEDTVICAKHPNVYFKIPNNLKEGIPIGGGVQFVGKRQAGVDSEIMITECSPCPAFTCKNY SQ SVSGDTRLFQVYLKPNCDHEQLAESDSMGFVDFRELETPCRGKFLAWVRESITVNDCRRAATIMEVCSTAICPPLIAMSA SQ NSSRATSARTTPAGSSIGSRSSIQSRASAATSVSSNRFVGPSSRRTPSGTPQSSTSSRV //