ID Q9NXW2; PN DnaJ homolog subfamily B member 12; GN DNAJB12; OS 9606; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Comments: Endoplasmic reticulum membrane {ECO:0000269|PubMed:21148293, ECO:0000269|PubMed:21150129, ECO:0000269|PubMed:24732912, ECO:0000269|PubMed:27916661}; Single-pass membrane protein {ECO:0000255}. Nucleus membrane {ECO:0000269|PubMed:24732912}; Single-pass membrane protein {ECO:0000305}. Note=Localizes to the endoplasmic reticulum membrane (PubMed:21150129, PubMed:21148293, PubMed:24732912, PubMed:27916661). When overexpressed, forms membranous structures in the nucleus (PubMed:24732912). {ECO:0000269|PubMed:21148293, ECO:0000269|PubMed:21150129, ECO:0000269|PubMed:24732912, ECO:0000269|PubMed:27916661}. DR UNIPROT: Q9NXW2; DR UNIPROT: B7Z7I3; DR UNIPROT: Q9H6H0; DR PDB: 2CTP; DR Pfam: PF00226; DR Pfam: PF09320; DR PROSITE: PS00636; DR PROSITE: PS50076; DR OMIM: 608376; DR DisGeNET: 54788; DE Function: Acts as a co-chaperone with HSPA8/Hsc70; required to promote protein folding and trafficking, prevent aggregation of client proteins, and promote unfolded proteins to endoplasmic reticulum- associated degradation (ERAD) pathway (PubMed:21150129, PubMed:21148293). Acts by determining HSPA8/Hsc70's ATPase and polypeptide-binding activities (PubMed:21148293). Can also act independently of HSPA8/Hsc70: together with DNAJB14, acts as a chaperone that promotes maturation of potassium channels KCND2 and KCNH2 by stabilizing nascent channel subunits and assembling them into tetramers (PubMed:27916661). While stabilization of nascent channel proteins is dependent on HSPA8/Hsc70, the process of oligomerization of channel subunits is independent of HSPA8/Hsc70 (PubMed:27916661). When overexpressed, forms membranous structures together with DNAJB14 and HSPA8/Hsc70 within the nucleus; the role of these structures, named DJANGOs, is still unclear (PubMed:24732912). {ECO:0000269|PubMed:21148293, ECO:0000269|PubMed:21150129, ECO:0000269|PubMed:24732912, ECO:0000269|PubMed:27916661}. (Microbial infection) In case of infection by polyomavirus, involved in the virus endoplasmic reticulum membrane penetration and infection (PubMed:21673190, PubMed:24675744). {ECO:0000269|PubMed:21673190, ECO:0000269|PubMed:24675744}. DE Reference Proteome: Yes; DE Interaction: P04626; IntAct: EBI-32718334; Score: 0.35 DE Interaction: P19438; IntAct: EBI-364378; Score: 0.00 DE Interaction: P08473; IntAct: EBI-1389788; Score: 0.35 DE Interaction: P01106; IntAct: EBI-3893169; Score: 0.35 DE Interaction: P0DOE9; IntAct: EBI-6138583; Score: 0.35 DE Interaction: O95429; IntAct: EBI-9393134; Score: 0.35 DE Interaction: Q96BE0; IntAct: EBI-9394503; Score: 0.35 DE Interaction: O43765; IntAct: EBI-9395484; Score: 0.35 DE Interaction: Q16659; IntAct: EBI-12502733; Score: 0.35 DE Interaction: P57078; IntAct: EBI-12503575; Score: 0.35 DE Interaction: P03182; IntAct: EBI-11721938; Score: 0.35 DE Interaction: P06792; IntAct: EBI-11724527; Score: 0.35 DE Interaction: P03431; IntAct: EBI-12579142; Score: 0.35 DE Interaction: Q1K9H5; IntAct: EBI-12588098; Score: 0.35 DE Interaction: B4URF7; IntAct: EBI-12588729; Score: 0.35 DE Interaction: Q6IQ23; IntAct: EBI-16398399; Score: 0.35 DE Interaction: Q13011; IntAct: EBI-16813992; Score: 0.35 DE Interaction: P14404; IntAct: EBI-21026252; Score: 0.35 DE Interaction: P04233; IntAct: EBI-21258980; Score: 0.35 DE Interaction: Q15077; IntAct: EBI-21262943; Score: 0.35 DE Interaction: F5H1C8; IntAct: EBI-21264930; Score: 0.35 DE Interaction: Q9H1C4; IntAct: EBI-21266770; Score: 0.35 DE Interaction: P05067; IntAct: EBI-21132574; Score: 0.35 DE Interaction: P49768; IntAct: EBI-21132675; Score: 0.35 DE Interaction: P03372; IntAct: EBI-21301141; Score: 0.35 DE Interaction: P17813; IntAct: EBI-22197897; Score: 0.35 DE Interaction: P51617; IntAct: EBI-28935882; Score: 0.35 DE Interaction: Q9UM73; IntAct: EBI-32717464; Score: 0.35 DE Interaction: Q5JZY3; IntAct: EBI-32717780; Score: 0.35 DE Interaction: P08069; IntAct: EBI-32718669; Score: 0.35 DE Interaction: P04629; IntAct: EBI-32719115; Score: 0.35 DE Interaction: Q16288; IntAct: EBI-32719212; Score: 0.35 GO GO:0005783; GO GO:0005789; GO GO:0030176; GO GO:0016020; GO GO:0031965; GO GO:0030544; GO GO:0071218; GO GO:0051085; GO GO:0036503; GO GO:0065003; GO GO:0030433; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MESNKDEAERCISIALKAIQSNQPDRALRFLEKAQRLYPTPRVRALIESLNQKPQTAGDQPPPTDTTHATHRKAGGTDAP SQ SANGEAGGESTKGYTAEQVAAVKRVKQCKDYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAV SQ LSNPEKRKQYDQFGDDKSQAARHGHGHGDFHRGFEADISPEDLFNMFFGGGFPSSNVHVYSNGRMRYTYQQRQDRRDNQG SQ DGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDD SQ YIANLRNNCWKEKQQKEGLLYRARYFGDTDMYHRAQKMGTPSCSRLSEVQASLHG //