ID  Q9QYN5;
PN  B-cell lymphoma/leukemia 10;
GN  Bcl10;
OS  10116;
SL  Nucleus Position: SL-0198;
SL  Comments: Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:O95999}. Membrane raft {ECO:0000250|UniProtKB:O95999}. Note=Appears to have a perinuclear, compact and filamentous pattern of expression. Also found in the nucleus of several types of tumor cells. Colocalized with DPP4 in membrane rafts. {ECO:0000250|UniProtKB:O95999}.
DR  UNIPROT: Q9QYN5;
DR  Pfam: PF00619;
DR  PROSITE: PS50209;
DE  Function: Plays a key role in both adaptive and innate immune signaling by bridging CARD domain-containing proteins to immune activation. Acts by channeling adaptive and innate immune signaling downstream of CARD domain-containing proteins CARD9, CARD11 and CARD14 to activate NF- kappa-B and MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14) pathways which stimulate expression of genes encoding pro-inflammatory cytokines and chemokines. Recruited by activated CARD domain-containing proteins: homooligomerized CARD domain-containing proteins form a nucleating helical template that recruits BCL10 via CARD-CARD interaction, thereby promoting polymerization of BCL10, subsequent recruitment of MALT1 and formation of a CBM complex. This leads to activation of NF-kappa-B and MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14) pathways which stimulate expression of genes encoding pro-inflammatory cytokines and chemokines. Activated by CARD9 downstream of C-type lectin receptors; CARD9-mediated signals are essential for antifungal immunity. Activated by CARD11 downstream of T- cell receptor (TCR) and B-cell receptor (BCR). Promotes apoptosis, pro- caspase-9 maturation and activation of NF-kappa-B via NIK and IKK. {ECO:0000250|UniProtKB:O95999}.
DE  Reference Proteome: Yes;
GO  GO:0032449;
GO  GO:0005737;
GO  GO:0005881;
GO  GO:0005829;
GO  GO:0001772;
GO  GO:0005764;
GO  GO:0045121;
GO  GO:0005634;
GO  GO:0048471;
GO  GO:0002096;
GO  GO:0032991;
GO  GO:0050700;
GO  GO:0019899;
GO  GO:0140296;
GO  GO:0042802;
GO  GO:0019209;
GO  GO:0019900;
GO  GO:0051059;
GO  GO:0002020;
GO  GO:0008022;
GO  GO:0043422;
GO  GO:0019901;
GO  GO:0043621;
GO  GO:0044877;
GO  GO:0003713;
GO  GO:0031625;
GO  GO:0002250;
GO  GO:0061760;
GO  GO:0001783;
GO  GO:0008219;
GO  GO:0006968;
GO  GO:0071222;
GO  GO:0071260;
GO  GO:0007249;
GO  GO:0016064;
GO  GO:0045087;
GO  GO:0031663;
GO  GO:0002906;
GO  GO:0001843;
GO  GO:0043065;
GO  GO:0043280;
GO  GO:0001819;
GO  GO:0045893;
GO  GO:2001238;
GO  GO:0043123;
GO  GO:0032757;
GO  GO:0051092;
GO  GO:0042327;
GO  GO:0031398;
GO  GO:0050870;
GO  GO:0050862;
GO  GO:0051260;
GO  GO:0050856;
GO  GO:0032094;
GO  GO:0009620;
GO  GO:0070231;
GO  GO:0050852;
GO  GO:0002224;
TP  Membrane Topology: Unknown; Source: UniProt - Sequence Analysis;
SQ  MEAPAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLDYLQENPKGLD
SQ  TLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCSSCEPFAAGATNNLSRSNSDESNFSEKQRPSTVIYHPEGES
SQ  STAPFFSTESSLNLPVLEVGRLENSSFSSASLPRPGDPGAPPLPPDLRLEEGGSCGNSSEMFLPLRSRALSRQ
//