ID Q9V3H8; PN NTF2-related export protein; GN Nxt1; OS 7227; SL Nucleus Position: SL-0178; SL Comments: Nucleus {ECO:0000269|PubMed:31384064}. Nucleus envelope {ECO:0000269|PubMed:31384064}. Note=Associates with the nuclear pore complex. {ECO:0000269|PubMed:31384064}. DR UNIPROT: Q9V3H8; DR PDB: 6IHJ; DR PDB: 6MRK; DR Pfam: PF02136; DR PROSITE: PS50177; DE Function: Stimulator of protein export for NES-containing proteins (By similarity). Plays a role in the nuclear export of mRNA (PubMed:14729961). Also plays a role in the nuclear export of U1 snRNA, tRNA, and mRNA (By similarity). In ovaries, plays a role in transposable element silencing regulation (PubMed:31219034, PubMed:31368590, PubMed:31384064, PubMed:31570835, PubMed:33856346). Forms a complex with nxf2, Panx and piwi which acts as effector of cotranscriptional transposon silencing (PubMed:31219034, PubMed:31368590, PubMed:31384064, PubMed:31570835). In ovarian follicle cells, enables the nuclear export of flamenco (flam) transcripts and subsequent piRNA biogenesis (PubMed:33856346). {ECO:0000250|UniProtKB:Q9UKK6, ECO:0000269|PubMed:14729961, ECO:0000269|PubMed:31219034, ECO:0000269|PubMed:31368590, ECO:0000269|PubMed:31384064, ECO:0000269|PubMed:31570835, ECO:0000269|PubMed:33856346}. DE Reference Proteome: Yes; DE Interaction: Q9U1H9; IntAct: EBI-873824; Score: 0.27 DE Interaction: Q8IQK4; IntAct: EBI-15170706; Score: 0.49 GO GO:0005737; GO GO:0005635; GO GO:0044613; GO GO:0005654; GO GO:0005634; GO GO:0017053; GO GO:0050829; GO GO:0045824; GO GO:0006913; GO GO:0016973; GO GO:0006606; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MDSDLKAKVESCARTADTFTRLYYASVDNRRQQIGRLYLDNATLSWNGNGAIGRQMIESYFQELPSSNHQLNTLDAQPIV SQ DQAVSNQLAYLIMASGSVKFADQQLRKFQQTFIVTAENDKWKVVSDCYRMQEV //