ID Q9V466; PN Nuclear pore complex protein Nup107; GN Nup107; OS 7227; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Nucleus Position: SL-0185; SL Comments: Nucleus, nuclear pore complex {ECO:0000269|PubMed:26502056, ECO:0000269|PubMed:31784359}. Nucleus envelope {ECO:0000269|PubMed:18562695, ECO:0000269|PubMed:27402967}. Nucleus membrane {ECO:0000269|PubMed:26485283}. Cytoplasm, cytoskeleton, spindle {ECO:0000269|PubMed:18562695}. Chromosome {ECO:0000269|PubMed:18562695, ECO:0000269|PubMed:31784359}. Nucleus matrix {ECO:0000269|PubMed:27402967, ECO:0000269|PubMed:31784359}. Note=Located on both the cytoplasmic and nuclear sides of the NPC core structure (By similarity). During syncytial embryo and larval neuroblast mitosis localizes to the nuclear envelope in interphase, accumulates in the nucleus in prometaphase, localizes to the spindle envelope in metaphase and then to condensing chromatin in telophase (PubMed:18562695). In spermatocytes, detected in the nuclear matrix by the nuclear envelope in metaphase I, and in the spindle envelope in premeiotic nuclei and during anaphase I (PubMed:27402967). Colocalizes with type-B lamin Lam throughout meiosis I (PubMed:27402967). Unlike in mammals, does not localize to kinetochore (PubMed:18562695, PubMed:27402967). Can localize to the nuclear lumen proximal to the inner nuclear membrane (PubMed:31784359). {ECO:0000250|UniProtKB:P57740, ECO:0000269|PubMed:18562695, ECO:0000269|PubMed:27402967, ECO:0000269|PubMed:31784359}. DR UNIPROT: Q9V466; DR Pfam: PF04121; DE Function: Plays a role in nuclear pore complex (NPC) assembly and maintenance (PubMed:20547758). Required for nuclear import of Mad (PubMed:20547758). Mediates the association between the nuclear pore complex and a subset of active chromatin regions adjacent to lamin- associated domains (PubMed:31784359). Plays a role in double strand break repair by relocalizing the heterochromatic double strain breaks (DSBs) to the nuclear periphery as part of the homologous recombination (HR) repair process (PubMed:26502056). Regulates cytokinesis during spermatocyte meiosis by maintaining type-B lamin Lam localization to the spindle envelope (PubMed:27402967). Regulates female gonad development and oogenesis (PubMed:26485283). {ECO:0000269|PubMed:20547758, ECO:0000269|PubMed:26485283, ECO:0000269|PubMed:26502056, ECO:0000269|PubMed:27402967, ECO:0000269|PubMed:31784359}. DE Reference Proteome: Yes; DE Interaction: P18459; IntAct: EBI-198339; Score: 0.00 DE Interaction: Q24568; IntAct: EBI-9944837; Score: 0.35 DE Interaction: Q9VWG6; IntAct: EBI-235243; Score: 0.00 DE Interaction: O44424; IntAct: EBI-239128; Score: 0.00 DE Interaction: Q95TK5; IntAct: EBI-246466; Score: 0.00 DE Interaction: P02844; IntAct: EBI-260156; Score: 0.00 DE Interaction: Q9W2N5; IntAct: EBI-267738; Score: 0.00 DE Interaction: Q9W4M8; IntAct: EBI-26767641; Score: 0.49 GO GO:0005694; GO GO:0005737; GO GO:0005635; GO GO:0016363; GO GO:0031965; GO GO:0034399; GO GO:0005643; GO GO:0031080; GO GO:0005819; GO GO:0003682; GO GO:0017056; GO GO:0000724; GO GO:0030703; GO GO:0008585; GO GO:0007112; GO GO:0007110; GO GO:0006406; GO GO:1900182; GO GO:0000973; GO GO:0006606; GO GO:0006355; GO GO:0046822; GO GO:0048137; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MADSPFPRSSRSGLLRTTLNSSMPPQNLSHSLLILEKSNAEQNELSLMEDTGDDLDRGKSRMDVLFPQFFDVLQAQGNGQ SQ EAFEVIQSLTQVCRGVVEQLELEIDHGMGGEQGARQRESMLTWLRQEINTWRLLHALFYDRILLQTDRQADDEMQDGPTL SQ GGSEKEVIQQLYALNATLREYQLVVDWLEACYDRGEQQNPLHAHDRMMAWENTLFQLENLQGAAFGKGHKIVTRLDPDAP SQ VREKRPLHALDEEDNLRLSRAIFELIRAGRVDDGLKLCKHFGQTWRAAILEGWRLHEDPNFEQNVSVLHEKLPIEGNPRR SQ DIWKRCAWMLADSKNYDEYSRATAGVFSGHLGSLKTLLHSNWHDLLWAHLKVQIDIRVESEIRGCCLKNYQPMPDDYWNG SQ RMTMEQIFEELNVAKDASVRDFAQSQLGIIQRHLILDTCGELIQHMVRWVEKDTSQQSPHQLRFMAHIVLFLRQIGRVEQ SQ ERQAEKIVAAYVEALIARGEPQLIAYYTASLSNPLQVQLYSRFLEQVEQKRPRELAVDAALQAGLDVEQITRVTVQNIRL SQ AHQPLGEFGEPQSGEISAIDQRKISALEWLIHLPEQRGELLWQANAMIRTYLASSKVECMRQTFRMVPADIVQQLVSLYG SQ SVDNIPPREECCLKEYLCYKAYLSGVDSFVEWNRLQQNRPKKPQTSHAASSQDNFTERMASERKEQAHRSEVVRWEHKVK SQ EQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLSWDHRLLQMEKLRSICIPEIALFLNEVMFKSGDFAGCVRLADE SQ ISSENRQLYKVYTKHKLAELLAKIADASLELLNSKLDPWGYPITT //