ID Q9VJL6; PN Glia maturation factor; GN GMF; OS 7227; SL Nucleus Position: SL-0198; SL Comments: Cell projection, lamellipodium {ECO:0000269|PubMed:25308079}. Cytoplasm, perinuclear region {ECO:0000269|PubMed:25308079}. Nucleus {ECO:0000269|PubMed:25308079}. Cytoplasm, cell cortex {ECO:0000269|PubMed:25308079}. Note=Colocalizes with F-actin and Arp2/3-nucleated actin arrays. {ECO:0000269|PubMed:25308079}. DR UNIPROT: Q9VJL6; DR UNIPROT: Q8MSR7; DR UNIPROT: Q9NK59; DR Pfam: PF00241; DR PROSITE: PS51263; DE Function: Inhibits Arp2/3-mediated actin nucleation (PubMed:25308079). Together with flr, promotes Arp2/3-nucleated actin filament array disassembly (PubMed:25308079). Promotes debranching (PubMed:25308079). Regulates lamellipodial protrusion dynamics possibly by facilitating lamellipodial retraction (PubMed:25308079). In egg chambers, enhances the retraction dynamics of cellular extensions in border cells and thus together with flr plays an important role in directional migration of border cell clusters (PubMed:25308079). {ECO:0000269|PubMed:25308079}. DE Reference Proteome: Yes; DE Interaction: Q95RB1; IntAct: EBI-238317; Score: 0.00 DE Interaction: Q9VJA1; IntAct: EBI-242035; Score: 0.00 GO GO:0071944; GO GO:0030027; GO GO:0005634; GO GO:0048471; GO GO:0003779; GO GO:0071933; GO GO:0071846; GO GO:0007298; GO GO:0034316; GO GO:0030833; GO GO:0031344; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MSDNQICDISNEVLEELKKFRFSKSKNNAALILKVDREKQTVVLDEFIDDISVDELQDTLPGHQPRYVIYTYKMVHDDQR SQ ISYPMCFIFYTPRDSQIELQMMYACTKSALQREVDLTRVYEIRELDELTEEWLKAKLK //